Rv0398c Family assigned · low

H37Rv Rv0398c · MTBC0 mtbc0_000418 · 213 aa · 480043–480684 (-) · RefSeq NP_214912.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Secreted protein with a solved structure (PDB 7YD4, Rv0398c itself); fold characterised, precise function not established.

Curated reference (UniProt)

UniProt P95206 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible secreted protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AUEU

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.075 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 70.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7yd4-assembly1_A 1.00 0.78 2.9e-22 sig 7yd4-assembly1_A Crystal structure of an N terminal truncated secreted protein, Rv0398c from Mycobacterium tuberculosis
4lrt-assembly1_B 0.14 0.41 5.5e-01 4lrt-assembly1_B Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
4jn6-assembly1_D 0.12 0.38 5.8e-01 4jn6-assembly1_D Crystal Structure of the Aldolase-Dehydrogenase Complex from Mycobacterium tuberculosis HRv37
3vw8-assembly1_A 0.07 0.32 1.1e+00 3vw8-assembly1_A Crystal structure of human c-Met kinase domain with its inhibitor
4twn-assembly1_A 0.06 0.33 1.6e+00 4twn-assembly1_A Human EphA3 Kinase domain in complex with Birb796
4mxc-assembly1_A 0.04 0.38 4.3e+00 4mxc-assembly1_A Crystal structure of CMET in complex with novel inhibitor
3n9h-assembly1_A 0.03 0.65 6.7e+00 3n9h-assembly1_A Crystal Structural of mutant Y305A in the copper amine oxidase from hansenula polymorpha
3nbb-assembly1_A 0.03 0.64 6.7e+00 3nbb-assembly1_A Crystal structure of mutant Y305F expressed in E. coli in the copper amine oxidase from hansenula polymorpha

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE7 (acyl-CoA dehydrogenase FadE7), high confidence from genomic context alone (score 887 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0400c fadE7 acyl-CoA dehydrogenase FadE7 887 887 ctx neighborhood:881
Rv0399c lpqK lipoprotein LpqK 882 882 ctx neighborhood:881
Rv0401 transmembrane protein 616 616 ctx neighborhood:616

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7yd4-assembly1_A Crystal structure of an N terminal truncated secreted protein, (prob 1.00, E=3e-22, TM=0.78)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214912.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AUEU
  • Curated reference: UniProt P95206 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 70.7, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor fadE7
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000418|Rv0398c|
MGVIARVVGVAACGLSLAVLAAAPTAGAEPTGALPPMTSSGSGPVIGDGDAALRQRISQQLFSFGDPTVQEVDGSDAAQFITAAAAVADRDVASVFLPLQRVLGCQQNTAGSGAGFGARAYRRTDGQWGGAMLVVAKSTVSDVDALKACVKSGWRKATAGTPTSMCNNGWTYPPFADTRRGEEGYFVLLAGTASDFCSAPNANYRTTASSWPG