ppiA Resolved · high auto-curated

H37Rv Rv0009 · MTBC0 - · 182 aa · 12468–13016 (+) · RefSeq NP_214523.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)iron-regulated peptidyl-prolyl cis-trans isomerase PpiA
MTBC0 PGAP re-annotation
Revised (this work)Iron-regulated peptidyl-prolyl cis-trans isomerase PpiA. Pfam: Pro_isomerase (PF00160.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHW3 SwissProt · reviewed · Evidence at protein level
UniProt namePeptidyl-prolyl cis-trans isomerase A
EC (curated) EC 5.2.1.8
Curated functionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameppiA
eggNOG descriptionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
Orthologous groupCOG0652
EC number EC 5.2.1.8
KEGG orthology K03767, K03768
KEGG pathways map01503, map04217
Gene Ontology (43) GO:0000413, GO:0003674, GO:0003755, GO:0003824, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886 +31 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.132 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pro_isomerasePF00160.27 3.5e-4818–180 Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2048c pks12 polyketide synthase 926 919 experimental:910
Rv2940c mas multifunctional mycocerosic acid synthase 926 919 experimental:910
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 925 919 experimental:910
Rv1527c pks5 polyketide synthase 925 918 experimental:910
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 925 918 experimental:910
Rv3211 rhlE ATP-dependent RNA helicase RhlE 880 873 experimental:473 database:626
Rv2299c htpG chaperone protein HtpG 886 872 experimental:465 database:655
Rv0714 rplN 50S ribosomal protein L14 861 857 coexpression:410 experimental:768
Rv1253 deaD ATP-dependent RNA helicase DeaD 861 853 experimental:473 database:626
Rv0682 rpsL 30S ribosomal protein S12 854 847 coexpression:782
Rv1663 pks17 polyketide synthase 842 835 experimental:821
Rv0704 rplB 50S ribosomal protein L2 838 832 coexpression:710 experimental:445
Rv0715 rplX 50S ribosomal protein L24 831 832 experimental:779
Rv0640 rplK 50S ribosomal protein L11 837 831 experimental:777
Rv3443c rplM 50S ribosomal protein L13 838 829 experimental:768

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): iron-regulated peptidyl-prolyl cis-trans isomerase PpiA
  • Pfam (hmmscan --cut_ga): Pro_isomerase PF00160.27 (E=3e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214523.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pro_isomerase (PF00160.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0652
  • Curated reference: UniProt P9WHW3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 226 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0009|ppiA
MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS