metZ Resolved · high auto-curated
H37Rv Rv0391 · MTBC0 mtbc0_000410 ·
406 aa ·
473374–474594 MTBC0
(+) ·
RefSeq NP_214905.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | O-succinylhomoserine sulfhydrylase |
|---|---|
| MTBC0 PGAP re-annotation | O-succinylhomoserine sulfhydrylase |
| Revised (this work) | O-succinylhomoserine sulfhydrylase. Pfam: Cys_Met_Meta_PP (PF01053.27). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| A pH-dependent direct sulfhydrylation pathway is required for the pathogenesis of Mycobacterium tuberculosis. doi:10.1038/s42003-025-08051-6 | 2025 |
| Folic acid supplementation and malaria susceptibility and severity among people taking antifolate antimalarial drugs in endemic areas. doi:10.1002/14651858.CD014217 | 2022 |
| [Meaning of the Quantiferon TB Gold tube test in tuberculosis screening among the hospital staff in case of very old or recent positive skin tests]. doi:10.1016/j.patbio.2008.07.001 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv0390 (Rv0390, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
1 reported modified residue(s):
N6-(pyridoxal phosphate)lysine @219.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index 0.20 (95% CI -2.57 to 3.66). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in methionine biosynthesis. Converts O-succinylhomoserine into homocysteine. |
|---|---|
| Mycobrowser EC |
4.2.99.-
· differs from the atlas (2.5.1.-) — O-succinylhomoserine sulfhydrylase MetZ (transferase 2.5.1.-); Mycobrowser's 4.2.99.- is superseded
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0397
· 100.0% identity |
|---|---|
| M. leprae |
ML0275c
· 87.9% identity |
| M. marinum |
MMAR_0688
· 87.1% identity |
| M. smegmatis |
MSMEG_0769
· 85.5% identity |
| M. orygis |
RJtmp_000407
· 100.0% identity |
| M. abscessus |
MAB_4242c
· 82.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGB5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | O-succinylhomoserine sulfhydrylase |
| EC (curated) |
EC 2.5.1.-
|
| Curated function | Catalyzes the formation of L-homocysteine from O-succinyl-L-homoserine (OSHS) and hydrogen sulfide. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | metZ |
| eggNOG description | Catalyzes the formation of L-homocysteine from O- succinyl-L-homoserine (OSHS) and hydrogen sulfide |
| Orthologous group | COG0626 |
| KEGG orthology |
K10764
|
| KEGG pathways |
map00270, map00920, map01100
|
| Gene Ontology (8) |
GO:0003674, GO:0003824, GO:0003962, GO:0004123, GO:0016740, GO:0016765, GO:0016829, GO:0016846
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.176 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.176 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 88.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 52.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) cholesterol-required
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 22 in the ORF — 0 in the essential state, 0 growth-defect, 22 non-essential, 0 growth-advantage. Saturation 0.773, mean read count 83.8235294118. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Cholesterol catabolism | required for growth on cholesterol (Griffin 2011) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness on cholesterol (vs glycerol) (carbon source) | -4.03 | 0.019 | required |
| fitness after prolonged in vitro passage (in vitro passage) | -3.43 | 0.0068 | required |
| fitness in mouse infection (in vivo) | -2.20 | 0.043 | required |
| fitness in mouse infection (in vivo) | -2.14 | 0.041 | required |
| fitness in mouse infection (in vivo) | -1.76 | 0.047 | required |
| fitness in mouse infection (in vivo) | -1.68 | 0.04 | required |
| fitness in mouse infection (in vivo) | -1.04 | 0.01 | required |
Conditional fitness of transposon-disruption mutants across 7 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 482.0 ppm · rank 420/3519 (88.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 406 aa |
|---|---|
| Molecular weight | 43.3 kDa |
| Theoretical pI | 5.32 |
| GRAVY | 0.063 (hydrophobic) |
| Aliphatic index | 91.8 |
| Aromaticity | 0.076 |
| Instability index | 34.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Cys_Met_Meta_PP | PF01053.27 | 6.4e-134 | 21–405 | Cys/Met metabolism PLP-dependent enzyme |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3ndn |
X-ray diffraction | 1.85 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3ndn-assembly1_D |
1.00 | 1.00 | 4.3e-82 sig | 3ndn-assembly1_D Crystal structure of O-succinylhomoserine sulfhydrylase from Mycobacterium tuberculosis covalently bound to pyridoxal-5-phosphate |
5x5h-assembly1_A |
1.00 | 0.95 | 1.6e-43 sig | 5x5h-assembly1_A Crystal structure of metB from Corynebacterium glutamicum |
8sf4-assembly1_A |
1.00 | 0.95 | 2.1e-42 sig | 8sf4-assembly1_A Cystathionine gamma lyase from Thermobifida fusca in internal aldimine form |
3qhx-assembly1_D |
1.00 | 0.94 | 1.9e-42 sig | 3qhx-assembly1_D Crystal Structure of Cystathionine gamma-synthase MetB (Cgs) from Mycobacterium ulcerans Agy99 bound to HEPES |
3qi6-assembly1_D |
1.00 | 0.95 | 1.9e-41 sig | 3qi6-assembly1_D Crystal Structure of Cystathionine gamma-synthase MetB (Cgs) from Mycobacterium ulcerans Agy99 |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv0390 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | ndhA (- strand, -4 bp gap) |
| Predicted operon |
purT · Rv0390 · metZ
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1077 cbs exp |
cystathionine beta-synthase | 984 | 980 | coexpression:713 database:900 |
Rv2124c metH exp |
methionine synthase | 982 | 969 | coexpression:644 database:900 textmining:445 |
Rv2334 cysK1 exp |
O-acetylserine sulfhydrylase | 967 | 955 | coexpression:474 database:900 |
Rv3684 exp |
lyase | 956 | 953 | coexpression:467 database:900 |
Rv1133c metE exp |
5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase | 960 | 945 | coexpression:452 database:900 |
Rv3340 metC exp |
O-acetylhomoserine sulfhydrylase | 944 | 936 | database:900 |
Rv3341 metA exp |
homoserine O-acetyltransferase | 957 | 931 | database:900 textmining:409 |
Rv2391 sirA exp |
sulfite reductase | 950 | 931 | database:900 |
Rv2294 exp |
cystathionine beta-lyase | 934 | 924 | database:900 |
Rv0075 exp |
aminotransferase | 934 | 924 | database:900 |
Rv0390 hyp |
hypothetical protein | 925 | 921 ctx | neighborhood:882 |
Rv3248c sahH exp |
adenosylhomocysteinase | 950 | 918 | database:900 textmining:428 |
Rv2458 mmuM exp |
homocysteine S-methyltransferase MmuM | 927 | 918 | database:900 |
Rv1079 metB exp |
cystathionine gamma-synthase | 925 | 916 | database:900 |
Rv0331 exp |
dehydrogenase/reductase | 912 | 904 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: O-succinylhomoserine sulfhydrylase
- MTBC0 PGAP product: O-succinylhomoserine sulfhydrylase
- Pfam (hmmscan --cut_ga): Cys_Met_Meta_PP PF01053.27 (E=6e-134)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214905.1)
- Domains: Pfam-A via hmmscan --cut_ga — Cys_Met_Meta_PP (PF01053.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0626 - Curated reference: UniProt P9WGB5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 55 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000410|Rv0391|metZ MTDESSVRTPKALPDGVSQATVGVRGGMLRSGFEETAEAMYLTSGYVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHIDGQGRVLGGAILGDREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQRIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVLDKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIADIDRALS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for metZ? Email the maintainer — the message is pre-filled with this gene's details.