Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | O-succinylhomoserine sulfhydrylase |
|---|
| MTBC0 PGAP re-annotation | O-succinylhomoserine sulfhydrylase |
|---|
| Revised (this work) | O-succinylhomoserine sulfhydrylase. Pfam: Cys_Met_Meta_PP (PF01053.27). |
|---|
Auto-curated: this verdict and function were generated by rules from
PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGB5
SwissProt · reviewed
· Evidence at protein level
|
|---|
| UniProt name | O-succinylhomoserine sulfhydrylase |
|---|
| EC (curated) |
EC 2.5.1.-
|
|---|
| Curated function | Catalyzes the formation of L-homocysteine from O-succinyl-L-homoserine (OSHS) and hydrogen sulfide. |
|---|
Functional vocabulary (eggNOG-mapper, orthology transfer)
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are
computed annotations, not manual curation; cross-check against the primary literature
before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS |
0.176 · strong purifying
|
|---|
| Polymorphic sites (≥ 0.1% of strains) |
2 synonymous, 1 missense, 0 nonsense, 0 frameshift
|
|---|
pN/pS from segregating SNPs (singletons removed) normalised by possible sites.
Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene).
A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic
variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A
clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a
convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|
Cys_Met_Meta_PP | PF01053.27 |
6.4e-134 | 21–405 |
Cys/Met metabolism PLP-dependent enzyme |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|
Rv1077 cbs |
cystathionine beta-synthase |
984 |
980 |
coexpression:713 database:900 |
Rv2124c metH |
methionine synthase |
982 |
969 |
coexpression:644 database:900 textmining:445 |
Rv2334 cysK1 |
O-acetylserine sulfhydrylase |
967 |
955 |
coexpression:474 database:900 |
Rv3684 |
lyase |
956 |
953 |
coexpression:467 database:900 |
Rv1133c metE |
5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase |
960 |
945 |
coexpression:452 database:900 |
Rv3340 metC |
O-acetylhomoserine sulfhydrylase |
944 |
936 |
database:900 |
Rv3341 metA |
homoserine O-acetyltransferase |
957 |
931 |
database:900 textmining:409 |
Rv2391 sirA |
sulfite reductase |
950 |
931 |
database:900 |
Rv2294 |
cystathionine beta-lyase |
934 |
924 |
database:900 |
Rv0075 |
aminotransferase |
934 |
924 |
database:900 |
Rv0390 hyp |
hypothetical protein |
925 |
921 ctx |
neighborhood:882 |
Rv3248c sahH |
adenosylhomocysteinase |
950 |
918 |
database:900 textmining:428 |
Rv2458 mmuM |
homocysteine S-methyltransferase MmuM |
927 |
918 |
database:900 |
Rv1079 metB |
cystathionine gamma-synthase |
925 |
916 |
database:900 |
Rv0331 |
dehydrogenase/reductase |
912 |
904 |
database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression,
experimental, database, text-mining) into a 0–1000 score. The ctx
badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion,
phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an
unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not
depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with
the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: O-succinylhomoserine sulfhydrylase
- MTBC0 PGAP product: O-succinylhomoserine sulfhydrylase
- Pfam (hmmscan --cut_ga): Cys_Met_Meta_PP PF01053.27 (E=6e-134)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024),
An imputed ancestral reference genome for the MTBC,
doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214905.1)
- Domains: Pfam-A via hmmscan --cut_ga — Cys_Met_Meta_PP (PF01053.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0626
- Curated reference: UniProt
P9WGB5
(SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of
145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
55 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000410|Rv0391|metZ
MTDESSVRTPKALPDGVSQATVGVRGGMLRSGFEETAEAMYLTSGYVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHIDGQGRVLGGAILGDREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQRIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVLDKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIADIDRALS
Spot an error? Suggest an improvement