Rv2367c Resolved · high auto-curated

H37Rv Rv2367c · MTBC0 - · 182 aa · 2648364–2648912 (-) · RefSeq NP_216883.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)endoribonuclease
MTBC0 PGAP re-annotation
Revised (this work)Endoribonuclease. Pfam: YbeY (PF02130.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WGX9 SwissProt · reviewed · Evidence at protein level
UniProt nameEndoribonuclease YbeY
EC (curated) EC 3.1.-.-
Curated functionSingle strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nameybeY
eggNOG descriptionSingle strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA
Orthologous groupCOG0319
KEGG orthology K07042

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.197 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YbeYPF02130.25 2.9e-3817–153 Endoribonuclease YbeY

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: phoH1 (phosphate starvation-inducible protein PhoH), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2368c phoH1 phosphate starvation-inducible protein PhoH 996 996 ctx neighborhood:881 coexpression:967
Rv2366c transmembrane protein 988 988 ctx neighborhood:882 coexpression:887
Rv2365c hyp hypothetical protein 977 976 ctx neighborhood:882 coexpression:807
Rv2364c era GTPase Era 976 973 ctx neighborhood:791 coexpression:877
Rv3846 sodA superoxide dismutase 919 907 experimental:903
Rv3456c rplQ 50S ribosomal protein L17 896 891 experimental:869
Rv2442c rplU 50S ribosomal protein L21 886 880 experimental:836
Rv0710 rpsQ 30S ribosomal protein S17 881 873 experimental:870
Rv0640 rplK 50S ribosomal protein L11 870 864 experimental:860
Rv0723 rplO 50S ribosomal protein L15 821 812 experimental:796
Rv3443c rplM 50S ribosomal protein L13 817 809 experimental:796
Rv0715 rplX 50S ribosomal protein L24 816 806 experimental:796
Rv0701 rplC 50S ribosomal protein L3 807 796 experimental:791
Rv2373c dnaJ2 chaperone protein DnaJ 787 774 ctx neighborhood:476 experimental:533
Rv2369c hyp hypothetical protein 775 774 ctx neighborhood:773

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): endoribonuclease
  • Pfam (hmmscan --cut_ga): YbeY PF02130.25 (E=3e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216883.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YbeY (PF02130.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0319
  • Curated reference: UniProt P9WGX9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 129 functional partner(s); context anchor phoH1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2367c|
MREHLMSIEVANESGIDVSEAELVSVARFVIAKMDVNPCAELSMLLLDTAAMADLHMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPSMLGDIVLCPEFAAEQAAAAGHSLGHELALLTIHGVLHLLGYDHAEPDEEKEMFALQDRLLEEWVADQVEAYQHDRQDEKDRRLLDKSRYFDL