Rv0057 Still unknown · low

H37Rv Rv0057 · MTBC0 mtbc0_000062 · 173 aa · 60004–60525 (+) · RefSeq NP_214571.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein. No Pfam-A domain above the gathering threshold and no Foldseek structural hit on the ESMFold model: genuinely uncharacterised at both the sequence and the structure level.

Curated reference (UniProt)

UniProt P9WM77 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized protein Rv0057

UniProt still lists this protein as Uncharacterized protein Rv0057; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.511 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 5.96% of strains (8649) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dnaB (replicative DNA helicase), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0058 dnaB replicative DNA helicase 943 889 ctx neighborhood:882 textmining:511
Rv0056 rplI 50S ribosomal protein L9 743 743 ctx neighborhood:731
Rv0055 rpsR1 30S ribosomal protein S18 645 644 ctx neighborhood:634
Rv0054 ssb single-strand DNA-binding protein 546 547 ctx neighborhood:523
Rv0059 darT hyp hypothetical protein 497 497 ctx neighborhood:473
Rv0060 darG hyp hypothetical protein 463 464 ctx neighborhood:450
Rv0053 rpsF 30S ribosomal protein S6 406 407
Rv0010c membrane protein 868 57 textmining:866
Rv0001 dnaA chromosomal replication initiator protein DnaA 437 50 textmining:432
Rv3843c transmembrane protein 870 47 textmining:870
Rv0011c crgA cell division protein CrgA 804 47 textmining:803
Rv3924c rpmH 50S ribosomal protein L34 655 41 textmining:655

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'hypothetical protein' (PGAP itself leaves it unannotated)
  • Pfam (hmmscan --cut_ga): no domain above threshold
  • Foldseek on the ESMFold model: no structural hit -- one of the few truly dark genes of the set

ESM Atlas signal (exploratory)

Ancestral protein hash be9ce41de1497f9ff42715afc4b5a900 · 10 ESM-space neighbours (max similarity 0.607). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
110621 1.33 Outer-membrane β-barrel initiation
2972 0.80 Ser/Thr/Gly-rich disordered regions
37187 0.77 Exposed polar low-structure patches
41738 0.77 Autotransporter passenger-translocator junction linker
53332 0.74 Mature N-terminal interaction region
64761 0.66 Arg/Ser/Thr-rich targeting leaders
72268 0.54 Transmembrane beta-barrel strands
811694 0.53 Secreted disordered acidic motifs

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214571.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WM77 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 32.1, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor dnaB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000062|Rv0057|
MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLNVRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVDGYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGGGESPWRSLMT