darG Resolved · high

H37Rv Rv0060 · MTBC0 mtbc0_000065 · 352 aa · 64017–65075 MTBC0 (+) · RefSeq NP_214574.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtoxin-antitoxin system antitoxin DNA ADP-ribosyl glycohydrolase DarG
Revised (this work)DarG (DarG_Mtb), antitoxin of the DarTG system: a macrodomain DNA ADP-ribosyl-glycohydrolase that removes the ADP-ribose mark deposited on DNA by the toxin DarT (Rv0059) and binds/neutralises it. In M. tuberculosis DarG is essential; its depletion triggers the DNA-damage response and cell death.
Functional category (TubercuList)conserved hypotheticals

In the literature (TB corpus sweep) 2 publications

Found under: H37Rv (2).

2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Potential biomarkers for evaluating the BCG vaccination response based on humoral immunity. doi:10.1016/j.heliyon.2024.e32117 2024
Depletion of the DarG antitoxin in Mycobacterium tuberculosis triggers the DNA-damage response and leads to cell death. doi:10.1111/mmi.14571 2020

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): WhiB4 (whiB4).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index -9.18 (95% CI -11.52 to -6.77). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0061 · 100.0% identity
M. orygis RJtmp_000065 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53605 SwissProt · reviewed · Evidence at protein level
UniProt nameDNA ADP-ribosyl glycohydrolase
EC (curated) EC 3.2.2.-
Curated functionAntitoxin component of the hybrid type II/IV toxin-antitoxin (TA) system DarTG, which plays a crucial role in controlling bacterial growth and bacteriophage infection. Keeps the toxin molecules in check under normal growth conditions. De-ADP-ribosylates DNA (probably) modified on thymidine by its cognate toxin DarT, which neutralizes the activity of DarT. Experiments in which DarG levels are depleted lead to cell death; expression of wild-type DarG protein from M.tuberculosis or T.aquaticus restores growth. Cells depleted of DarG are more sensitive to bedaquilline (targets respiration), DNA-da.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionMacro domain
Orthologous groupCOG2110

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.165 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) MTBC-specific

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 0/53 (0%) · 0/4 closest MTBAP relatives
SENSITIVITY DOWNGRADE: a divergent homolog is detectable at relaxed thresholds (weak hit 79%/43%cov in M_syngnathidarum — likely present but divergent); NOT a robust MTBC-specific innovation — present but divergent. The strict tblastn absence was a coverage/identity-threshold artefact.
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 23 in the ORF — 22 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.130, mean read count 198. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance27.4 ppm · rank 2121/3519 (39.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length352 aa
Molecular weight38.6 kDa
Theoretical pI6.27
GRAVY-0.128 (hydrophilic)
Aliphatic index92.0
Aromaticity0.077
Instability index30.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MacroPF01661.28 5.8e-2618–130 Macro domain

Experimental structures (Protein Data Bank) 2 solved

PDBMethodResolutionCoverage
7yk3 X-ray diffraction 2.2 Å 54%
5m3i X-ray diffraction 2.17 Å 44%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.3

PDB hitprobTM-scoreE-valueDescription
5m3i-assembly2_B 1.00 0.99 3.7e-23 sig 5m3i-assembly2_B Macrodomain of Mycobacterium tuberculosis DarG
7yk3-assembly1_B 1.00 0.95 7.0e-25 sig 7yk3-assembly1_B Crystal structure of DarTG toxin-antitoxin complex from Mycobacterium tuberculosis
7yk3-assembly2_D 1.00 0.95 1.2e-24 sig 7yk3-assembly2_D Crystal structure of DarTG toxin-antitoxin complex from Mycobacterium tuberculosis
5m31-assembly1_A 1.00 0.96 1.6e-16 sig 5m31-assembly1_A Macrodomain of Thermus aquaticus DarG
7omu-assembly2_BBB 1.00 0.84 5.3e-11 sig 7omu-assembly2_BBB Thermosipho africanus DarTG in complex with ADP-ribose

Foldseek search of the AlphaFold DB model (mean pLDDT 91.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv0059 (+ strand, 16 bp gap)
Downstream (3' on genome)Rv0061c (- strand, 44 bp gap)
Predicted operon Rv0059 · Rv0060

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: dnaB (replicative DNA helicase), medium confidence from genomic context alone (score 531 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0059 darT hyp hypothetical protein 989 947 ctx neighborhood:763 cooccurence:771 textmining:807
Rv0058 dnaB replicative DNA helicase 530 531 ctx neighborhood:463
Rv0056 rplI 50S ribosomal protein L9 477 478 ctx neighborhood:408
Rv0057 hyp hypothetical protein 463 464 ctx neighborhood:450
Rv2972c hyp hypothetical protein 423 420
Rv1151c cobB NAD-dependent protein deacylase 435 410
Rv1045 hyp hypothetical protein 508 164 textmining:436
Rv2368c phoH1 phosphate starvation-inducible protein PhoH 810 57 textmining:807
Rv0272c hyp hypothetical protein 804 50 textmining:803
Rv0909 antitoxin 532 47 textmining:529
Rv1546 hyp hypothetical protein 527 47 textmining:525
Rv1545 hyp hypothetical protein 515 47 textmining:512
Rv0836c hyp hypothetical protein 436 45 textmining:434
Rv1989c mbcT hyp hypothetical protein 660 44 textmining:659
Rv0837c hyp hypothetical protein 516 44 textmining:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'toxin-antitoxin system antitoxin DNA ADP-ribosyl glycohydrolase DarG'
  • Pfam (hmmscan --cut_ga): Macro PF01661 (E=5.8e-26), an ADP-ribose-binding / hydrolase macrodomain
  • Cognate antitoxin of Rv0059 (DarT); essential gene in M. tuberculosis

ESM Atlas signal (exploratory)

Ancestral protein hash c1dd089f1dcaf594f1fd0e9301281d44 · 9 ESM-space neighbours (max similarity 0.859). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
11227 1.16 Macrodomain ADP-ribose recognition
212615 1.06 Domain-edge interaction hotspots
315026 0.90 Nucleotide phosphate cofactor recognition
410450 0.90 Aromatic/Gly-rich core scaffold
53068 0.86 Divalent-metal hydrolase and ADP-ribose folds
615650 0.78 Mixed-charge amphipathic interaction helix
74753 0.77 C-terminal region detector
82443 0.61 Glycine aromatic clamp loops

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214574.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Macro (PF01661.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2110
  • Curated reference: UniProt O53605 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor dnaB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: Jankevicius G, Ariza A, Ahel M, Ahel I (2016). The Toxin-Antitoxin System DarTG Catalyzes Reversible ADP-Ribosylation of DNA Molecular Cell. doi:10.1016/j.molcel.2016.11.014 PMID:27939941
  • Primary literature: (2020). Depletion of the DarG antitoxin in Mycobacterium tuberculosis triggers the DNA-damage response and leads to cell death Molecular Microbiology. doi:10.1111/mmi.14571 PMID:32634279

Ancestral MTBC0 protein sequence

>mtbc0_000065|Rv0060|darG
MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTAYEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIRELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLRMTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRYGPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVSAAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDRIGVALDRILMTA