Rv3481c Family assigned · medium auto-curated

H37Rv Rv3481c · MTBC0 mtbc0_003696 · 229 aa · 3925075–3925764 (-) · RefSeq NP_217998.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationGAP family protein
Revised (this work)GAP family protein. Pfam: SfLAP (PF11139.15).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XHC3 TrEMBL · unreviewed · Predicted
UniProt nameProbable integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
eggNOG descriptionSap, sulfolipid-1-addressing protein
Orthologous groupCOG1280

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.14 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SfLAPPF11139.15 3.3e-6518–227 Sap, sulfolipid-1-addressing protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0048c (membrane protein), high confidence from genomic context alone (score 708 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0048c membrane protein 707 708 ctx cooccurence:707
Rv1171 hyp hypothetical protein 605 605 ctx cooccurence:604
Rv3480c diacyglycerol O-acyltransferase 591 591 ctx neighborhood:591
Rv3773c hyp hypothetical protein 570 571 ctx cooccurence:568
Rv1635c mannosyltransferase 545 545 ctx cooccurence:545
Rv2558 hyp hypothetical protein 525 525 ctx cooccurence:525
Rv3482c membrane protein 516 516 ctx neighborhood:516
Rv2557 hyp hypothetical protein 504 504 ctx cooccurence:504
Rv0711 atsA arylsulfatase AtsA 470 470 ctx cooccurence:468
Rv1624c membrane protein 459 460 ctx cooccurence:458
Rv2525c hyp hypothetical protein 450 450 ctx cooccurence:446
Rv3483c hyp hypothetical protein 431 431 ctx neighborhood:428
Rv0188 transmembrane protein 417 417 ctx cooccurence:417
Rv2487c PE_PGRS42 PE-PGRS family protein PE_PGRS42 415 415 ctx cooccurence:415
Rv3435c transmembrane protein 414 414 ctx cooccurence:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: GAP family protein
  • Pfam (hmmscan --cut_ga): SfLAP PF11139.15 (E=3e-65)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217998.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SfLAP (PF11139.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1280
  • Curated reference: UniProt I6XHC3 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor Rv0048c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003696|Rv3481c|
MRGLLPVAGHWVSVLTGLVPLALVIALSPLSVIPAVLVVHSPQPRPSSLAFLGGWLLGLAVVTAVFVAASGALGGLSTTSPAWASWLRVVLGSALIVFGVLRWLTRHRHTEMPGWMRAFASFTPARAGLVGAVLVVVRPEVLIICAAAGLAIGSGGHGAAGSWIYTAFFAMLAASTVAIPILAYVAAGDRLDDSLERLKDWMEKNHAGMVAAILVVIGLLLLYNGVHAM