canB Resolved · high auto-curated

H37Rv Rv3588c · MTBC0 mtbc0_003807 · 207 aa · 4053548–4054171 (-) · RefSeq NP_218105.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)carbonic anhydrase
MTBC0 PGAP re-annotationbeta-carbonic anhydrase CanB
Revised (this work)Beta-carbonic anhydrase CanB. Pfam: Pro_CA (PF00484.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPJ9 SwissProt · reviewed · Evidence at protein level
UniProt nameCarbonic anhydrase 2
EC (curated) EC 4.2.1.1
Curated functionCatalyzes the reversible hydration of carbon dioxide to form bicarbonate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namecynT
eggNOG descriptionreversible hydration of carbon dioxide
Orthologous groupCOG0288
EC number EC 4.2.1.1
KEGG orthology K01673
KEGG pathways map00910
Gene Ontology (12) GO:0003674, GO:0003824, GO:0004089, GO:0005488, GO:0008270, GO:0016829, GO:0016835, GO:0016836, GO:0043167, GO:0043169, GO:0046872, GO:0046914

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pro_CAPF00484.25 4.1e-3946–193 Carbonic anhydrase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mutY (A/G-specific adenine glycosylase), high confidence from genomic context alone (score 793 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3273 transmembrane carbonic anhydrase 967 918 database:900 textmining:623
Rv1284 canA beta-carbonic anhydrase 986 904 database:900 textmining:870
Rv3589 mutY A/G-specific adenine glycosylase 857 793 ctx neighborhood:792
Rv3587c membrane protein 771 771 ctx neighborhood:768
Rv2584c apt adenine phosphoribosyltransferase 776 768 coexpression:768
Rv1707 transmembrane protein 708 691 ctx fusion:612
Rv3525c siderophore-binding protein 853 573 experimental:570 textmining:670
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 480 264
Rv3411c guaB2 inosine-5'-monophosphate dehydrogenase 406 224
Rv0782 ptrBb Rv0782, (MTCY369.26), len: 552 aa. Probable ptrBb,second part of protease II, equivalent to C-terminus of NP_302455.1|NC_002677 protease II 608 170 textmining:548
Rv1202 dapE succinyl-diaminopimelate desuccinylase DapE 587 157 textmining:531
Rv1905c aao D-amino acid oxidase 543 101 textmining:513
Rv0427c xthA exodeoxyribonuclease III protein XthA 480 82 textmining:458
Rv3275c purE 5-(carboxyamino)imidazole ribonucleotide mutase 644 80 textmining:630
Rv0233 nrdB ribonucleoside-diphosphate reductase subunit beta NrdB 559 78 textmining:542

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: carbonic anhydrase
  • MTBC0 PGAP product: beta-carbonic anhydrase CanB
  • Pfam (hmmscan --cut_ga): Pro_CA PF00484.25 (E=4e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218105.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pro_CA (PF00484.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0288
  • Curated reference: UniProt P9WPJ9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor mutY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003807|Rv3588c|canB
MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEEV