canB Resolved · high auto-curated
H37Rv Rv3588c · MTBC0 mtbc0_003807 ·
207 aa · 4053548–4054171 (-) ·
RefSeq NP_218105.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | carbonic anhydrase |
|---|---|
| MTBC0 PGAP re-annotation | beta-carbonic anhydrase CanB |
| Revised (this work) | Beta-carbonic anhydrase CanB. Pfam: Pro_CA (PF00484.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WPJ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Carbonic anhydrase 2 |
| EC (curated) |
EC 4.2.1.1
|
| Curated function | Catalyzes the reversible hydration of carbon dioxide to form bicarbonate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | cynT |
| eggNOG description | reversible hydration of carbon dioxide |
| Orthologous group | COG0288 |
| EC number |
EC 4.2.1.1
|
| KEGG orthology |
K01673
|
| KEGG pathways |
map00910
|
| Gene Ontology (12) |
GO:0003674, GO:0003824, GO:0004089, GO:0005488, GO:0008270, GO:0016829, GO:0016835, GO:0016836, GO:0043167, GO:0043169, GO:0046872, GO:0046914
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.116 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pro_CA | PF00484.25 | 4.1e-39 | 46–193 | Carbonic anhydrase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mutY (A/G-specific adenine glycosylase), high confidence from genomic context alone (score 793 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3273 |
transmembrane carbonic anhydrase | 967 | 918 | database:900 textmining:623 |
Rv1284 canA |
beta-carbonic anhydrase | 986 | 904 | database:900 textmining:870 |
Rv3589 mutY |
A/G-specific adenine glycosylase | 857 | 793 ctx | neighborhood:792 |
Rv3587c |
membrane protein | 771 | 771 ctx | neighborhood:768 |
Rv2584c apt |
adenine phosphoribosyltransferase | 776 | 768 | coexpression:768 |
Rv1707 |
transmembrane protein | 708 | 691 ctx | fusion:612 |
Rv3525c |
siderophore-binding protein | 853 | 573 | experimental:570 textmining:670 |
Rv1843c guaB1 |
inosine-5'-monophosphate dehydrogenase | 480 | 264 | |
Rv3411c guaB2 |
inosine-5'-monophosphate dehydrogenase | 406 | 224 | |
Rv0782 ptrBb |
Rv0782, (MTCY369.26), len: 552 aa. Probable ptrBb,second part of protease II, equivalent to C-terminus of NP_302455.1|NC_002677 protease II | 608 | 170 | textmining:548 |
Rv1202 dapE |
succinyl-diaminopimelate desuccinylase DapE | 587 | 157 | textmining:531 |
Rv1905c aao |
D-amino acid oxidase | 543 | 101 | textmining:513 |
Rv0427c xthA |
exodeoxyribonuclease III protein XthA | 480 | 82 | textmining:458 |
Rv3275c purE |
5-(carboxyamino)imidazole ribonucleotide mutase | 644 | 80 | textmining:630 |
Rv0233 nrdB |
ribonucleoside-diphosphate reductase subunit beta NrdB | 559 | 78 | textmining:542 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: carbonic anhydrase
- MTBC0 PGAP product: beta-carbonic anhydrase CanB
- Pfam (hmmscan --cut_ga): Pro_CA PF00484.25 (E=4e-39)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218105.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pro_CA (PF00484.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0288 - Curated reference: UniProt P9WPJ9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
mutY - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003807|Rv3588c|canB MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEEV