xthA Resolved · high auto-curated

H37Rv Rv0427c · MTBC0 - · 291 aa · 516017–516892 H37Rv (-) · RefSeq NP_214941.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)exodeoxyribonuclease III protein XthA
MTBC0 PGAP re-annotation
Revised (this work)Exodeoxyribonuclease III protein XthA. Pfam: Exo_endo_phos (PF03372.30).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 7 publications

7 TB publications mention this gene. 7 publication(s) discuss this gene (7 in a M. tuberculosis context).

Most recent 5 of 7.
PublicationDate
XthA phospholipase contributes the cell-wall functionality of pathogenic mycobacteria by increasing the synthesis of mycolic acid. doi:10.1016/j.ijbiomac.2025.145519 2025
Genome wide analyses reveal the role of mutator phenotypes in Mycobacterium tuberculosis drug resistance emergence. doi:10.1038/s44259-025-00107-1 2025
Regulation of futile ligation during early steps of BER in M. tuberculosis is carried out by a β-clamp-XthA-LigA tri-component complex. doi:10.1016/j.ijbiomac.2022.11.094 2023
M. tuberculosis class II apurinic/ apyrimidinic-endonuclease/3'-5' exonuclease (XthA) engages with NAD+-dependent DNA ligase A (LigA) to counter futile cleavage and ligation cycles in base excision repair. doi:10.1093/nar/gkaa188 2020
Mycobacterium tuberculosis class II apurinic/apyrimidinic-endonuclease/3'-5' exonuclease III exhibits DNA regulated modes of interaction with the sliding DNA β-clamp. doi:10.1111/mmi.13102 2015

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.98 (95% CI -1.20 to 4.53). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in base excision repair. Apurinic-apyrimidinic endonuclease. Supposed to remove the damaged DNA at cytosines and guanines by cleaving at the 3' side of the AP site by a beta-elimination reaction. Possibly exhibites 3'-5'-exonuclease, 3'-phosphomonoesterase, 3'-repair diesterase and ribonuclease H activities [catalytic activity: degradation of double-stranded DNA. It acts progressively in
Mycobrowser EC 3.1.11.2 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0435c · 100.0% identity
M. marinum MMAR_0742 · 87.7% identity
M. smegmatis MSMEG_0829 · 75.2% identity
M. orygis RJtmp_000448 · 99.6% identity
M. abscessus MAB_4189 · 72.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P96273 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable exodeoxyribonuclease III protein XthA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namexthA
eggNOG descriptionexodeoxyribonuclease III
Orthologous groupCOG0708
EC number EC 3.1.11.2
KEGG orthology K01142
KEGG pathways map03410

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.649 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 83.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 60.4%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 92.9230769231. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 13 of 16 independent MS datasets
Integrated abundance89.9 ppm · rank 1368/3519 (61.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length291 aa
Molecular weight32.1 kDa
Theoretical pI5.15
GRAVY-0.279 (hydrophilic)
Aliphatic index80.8
Aromaticity0.096
Instability index39.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Exo_endo_phosPF03372.30 1.8e-3027–281 Endonuclease/Exonuclease/phosphatase family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.6

PDB hitprobTM-scoreE-valueDescription
6fke-assembly1_A 1.00 0.94 3.4e-29 sig 6fke-assembly1_A Structure of 3' phosphatase NExo (D146N) from Neisseria bound to product DNA hairpin
2voa-assembly1_B 1.00 0.95 2.1e-28 sig 2voa-assembly1_B Structure of an AP Endonuclease from Archaeoglobus fulgidus
2jc4-assembly1_A 1.00 0.94 4.9e-28 sig 2jc4-assembly1_A 3'-5' exonuclease (NExo) from Neisseria Meningitidis
1ako-assembly1_A 1.00 0.87 5.4e-24 sig 1ako-assembly1_A EXONUCLEASE III FROM ESCHERICHIA COLI
3w2y-assembly2_D 1.00 0.88 4.4e-23 sig 3w2y-assembly2_D Crystal structure of DNA uridine endonuclease Mth212 mutant W205S

Foldseek search of the AlphaFold DB model (mean pLDDT 93.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Catalytic-site verification (M-CSA on the structural model) active site conserved

M-CSA entry160 · EC 3.1.11.2
Catalytic residues7/7 identical (7/7 aligned)
VerdictACTIVE-SITE CONSERVED (7/7 catalytic residues identical) -> likely active enzyme

Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv0426c (- strand, 200 bp gap)
Downstream (3' on genome)Rv0428c (- strand, 2 bp gap)
Predicted operon xthA · Rv0428c · def

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) trcR (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: def (polypeptide deformylase), high confidence from genomic context alone (score 894 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0429c def polypeptide deformylase 952 894 ctx neighborhood:881 textmining:566
Rv0428c GCN5-like N-acetyltransferase 946 883 ctx neighborhood:881 textmining:562
Rv3589 mutY exp A/G-specific adenine glycosylase 903 865 experimental:428 database:771
Rv2116 lppK exp lipoprotein LppK 850 834 experimental:414 database:653
Rv0002 dnaN exp DNA polymerase III subunit beta 850 834 experimental:414 database:653
Rv0670 end exp endonuclease IV 951 826 experimental:825 textmining:732
Rv1711 RNA pseudouridine synthase 814 815 coexpression:805
Rv2976c ung exp uracil-DNA glycosylase 852 807 database:743
Rv3674c nth exp endonuclease III 823 799 experimental:403 database:641
Rv1870c hyp exp hypothetical protein 818 799 experimental:403 database:641
Rv1156 hyp exp hypothetical protein 818 799 experimental:403 database:641
Rv1629 polA exp DNA polymerase I 932 781 database:662 textmining:703
Rv1317c alkA exp bifunctional regulatory protein/DNA repair enzyme AlkA 894 759 database:651 textmining:579
Rv2090 exp 5'-3' exonuclease 778 748 database:662
Rv0938 ligD exp multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 763 738 database:644

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): exodeoxyribonuclease III protein XthA
  • Pfam (hmmscan --cut_ga): Exo_endo_phos PF03372.30 (E=2e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214941.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Exo_endo_phos (PF03372.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0708
  • Curated reference: UniProt P96273 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.6)
  • Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 160; catalytic residues aligned onto the structural model
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 71 functional partner(s); context anchor def
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0427c|xthA
MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWLGRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFDGQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTAEGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDHAPVLVDLHAG