Rv3525c Family assigned · low auto-curated

H37Rv Rv3525c · MTBC0 mtbc0_003741 · 174 aa · 3985477–3986001 (-) · RefSeq NP_218042.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)siderophore-binding protein
MTBC0 PGAP re-annotationgamma carbonic anhydrase family protein
Revised (this work)Gamma carbonic anhydrase family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YCB9 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible siderophore-binding protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namegca
eggNOG descriptionBacterial transferase hexapeptide (six repeats)
Orthologous groupCOG0663
Gene Ontology (17) GO:0003674, GO:0003824, GO:0004089, GO:0005488, GO:0008270, GO:0016829, GO:0016835, GO:0016836, GO:0043167, GO:0043168, GO:0043169, GO:0043199 +5 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.558 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: kshA (3-ketosteroid-9-alpha-monooxygenase oxygenase subunit), high confidence from genomic context alone (score 779 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3527 hyp hypothetical protein 780 779 ctx neighborhood:778
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 780 779 ctx neighborhood:778
Rv3273 transmembrane carbonic anhydrase 687 586 experimental:570
Rv3588c canB carbonic anhydrase 853 573 experimental:570 textmining:670
Rv1284 canA beta-carbonic anhydrase 629 573 experimental:570
Rv1302 rfe decaprenyl-phosphate N-acetylglucosaminephosphotransferase 495 477
Rv1381 pyrC dihydroorotase 492 473 coexpression:430
Rv0106 hyp hypothetical protein 488 459 coexpression:415
Rv3667 acs acetyl-CoAsynthetase 446 412
Rv2156c murX phospho-N-acetylmuramoyl-pentappeptidetransferase 426 405
Rv2535c pepQ cytoplasmic peptidase PepQ 483 109 textmining:444
Rv0677c mmpS5 membrane protein MmpS5 512 44 textmining:511
Rv0676c mmpL5 transmembrane transport protein MmpL5 443 44 textmining:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: siderophore-binding protein
  • MTBC0 PGAP product: gamma carbonic anhydrase family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218042.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0663
  • Curated reference: UniProt I6YCB9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor kshA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003741|Rv3525c|
MPLFSFEGRSPRIDPTAFVAPTATLIGDVTIEAGASVWFNAVLRGDYAPVVVREGANVQDGAVLHAPPGIPVDIGPGATVAHLCVIHGVHVGSEALIANHATVLDGAVIGARCMIAAGALVVAGTQIPAGMLVTGAPAKVKGPIEGTGAEMWVNVNPQAYRDLAARHLAGLEPM