canA Resolved · high auto-curated
H37Rv Rv1284 · MTBC0 mtbc0_001374 ·
163 aa · 1446307–1446798 (+) ·
RefSeq NP_215800.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | beta-carbonic anhydrase |
|---|---|
| MTBC0 PGAP re-annotation | beta-carbonic anhydrase CanA |
| Revised (this work) | Beta-carbonic anhydrase CanA. Pfam: Pro_CA (PF00484.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WPJ7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Beta-carbonic anhydrase 1 |
| EC (curated) |
EC 4.2.1.1
|
| Curated function | Catalyzes the reversible hydration of carbon dioxide to form bicarbonate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | mtcA1 |
| eggNOG description | reversible hydration of carbon dioxide |
| Orthologous group | COG0288 |
| EC number |
EC 4.2.1.1
|
| KEGG orthology |
K01673
|
| KEGG pathways |
map00910
|
| Gene Ontology (20) |
GO:0003674, GO:0003824, GO:0004089, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0008270, GO:0016020, GO:0016829, GO:0016835 +8 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.216 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pro_CA | PF00484.25 | 3.8e-12 | 31–115 | Carbonic anhydrase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: oppC (oligopeptide ABC transporter permease OppC), high confidence from genomic context alone (score 757 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3273 |
transmembrane carbonic anhydrase | 970 | 914 | database:900 textmining:675 |
Rv3588c canB |
carbonic anhydrase | 986 | 904 | database:900 textmining:870 |
Rv1282c oppC |
oligopeptide ABC transporter permease OppC | 767 | 757 ctx | neighborhood:756 |
Rv1280c oppA |
oligopeptide ABC transporter substrate-binding lipoprotein OppA | 756 | 756 ctx | neighborhood:756 |
Rv1283c oppB |
oligopeptide ABC transporter permease OppB | 756 | 756 ctx | neighborhood:756 |
Rv1286 cysC |
adenylyl-sulfate kinase | 647 | 599 ctx | neighborhood:567 |
Rv3525c |
siderophore-binding protein | 629 | 573 | experimental:570 |
Rv1285 cysD |
sulfate adenylyltransferase subunit 2 | 586 | 565 ctx | neighborhood:548 |
Rv1281c oppD |
oligopeptide ABC transporter ATP-binding protein OppD | 506 | 506 ctx | neighborhood:505 |
Rv2584c apt |
adenine phosphoribosyltransferase | 508 | 490 | coexpression:490 |
Rv1287 |
HTH-type transcriptional regulator | 443 | 443 ctx | neighborhood:437 |
Rv1843c guaB1 |
inosine-5'-monophosphate dehydrogenase | 423 | 259 | |
Rv3105c prfB |
peptide chain release factor PrfB | 454 | 221 | |
Rv1905c aao |
D-amino acid oxidase | 563 | 96 | textmining:537 |
Rv0854 hyp |
hypothetical protein | 569 | 86 | textmining:549 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: beta-carbonic anhydrase
- MTBC0 PGAP product: beta-carbonic anhydrase CanA
- Pfam (hmmscan --cut_ga): Pro_CA PF00484.25 (E=4e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215800.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pro_CA (PF00484.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0288 - Curated reference: UniProt P9WPJ7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
oppC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001374|Rv1284|canA MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP