canA Resolved · high auto-curated

H37Rv Rv1284 · MTBC0 mtbc0_001374 · 163 aa · 1446307–1446798 (+) · RefSeq NP_215800.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)beta-carbonic anhydrase
MTBC0 PGAP re-annotationbeta-carbonic anhydrase CanA
Revised (this work)Beta-carbonic anhydrase CanA. Pfam: Pro_CA (PF00484.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPJ7 SwissProt · reviewed · Evidence at protein level
UniProt nameBeta-carbonic anhydrase 1
EC (curated) EC 4.2.1.1
Curated functionCatalyzes the reversible hydration of carbon dioxide to form bicarbonate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namemtcA1
eggNOG descriptionreversible hydration of carbon dioxide
Orthologous groupCOG0288
EC number EC 4.2.1.1
KEGG orthology K01673
KEGG pathways map00910
Gene Ontology (20) GO:0003674, GO:0003824, GO:0004089, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0008270, GO:0016020, GO:0016829, GO:0016835 +8 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.216 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pro_CAPF00484.25 3.8e-1231–115 Carbonic anhydrase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: oppC (oligopeptide ABC transporter permease OppC), high confidence from genomic context alone (score 757 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3273 transmembrane carbonic anhydrase 970 914 database:900 textmining:675
Rv3588c canB carbonic anhydrase 986 904 database:900 textmining:870
Rv1282c oppC oligopeptide ABC transporter permease OppC 767 757 ctx neighborhood:756
Rv1280c oppA oligopeptide ABC transporter substrate-binding lipoprotein OppA 756 756 ctx neighborhood:756
Rv1283c oppB oligopeptide ABC transporter permease OppB 756 756 ctx neighborhood:756
Rv1286 cysC adenylyl-sulfate kinase 647 599 ctx neighborhood:567
Rv3525c siderophore-binding protein 629 573 experimental:570
Rv1285 cysD sulfate adenylyltransferase subunit 2 586 565 ctx neighborhood:548
Rv1281c oppD oligopeptide ABC transporter ATP-binding protein OppD 506 506 ctx neighborhood:505
Rv2584c apt adenine phosphoribosyltransferase 508 490 coexpression:490
Rv1287 HTH-type transcriptional regulator 443 443 ctx neighborhood:437
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 423 259
Rv3105c prfB peptide chain release factor PrfB 454 221
Rv1905c aao D-amino acid oxidase 563 96 textmining:537
Rv0854 hyp hypothetical protein 569 86 textmining:549

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: beta-carbonic anhydrase
  • MTBC0 PGAP product: beta-carbonic anhydrase CanA
  • Pfam (hmmscan --cut_ga): Pro_CA PF00484.25 (E=4e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215800.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pro_CA (PF00484.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0288
  • Curated reference: UniProt P9WPJ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor oppC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001374|Rv1284|canA
MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP