Rv0010c Family assigned · medium auto-curated

H37Rv Rv0010c · MTBC0 mtbc0_000014 · 141 aa · 13133–13558 (-) · RefSeq NP_214524.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationPH domain-containing protein
Revised (this work)PH domain-containing protein. Pfam: bPH_6 (PF10756.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMA3 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0010c

UniProt still lists this protein as Uncharacterized protein Rv0010c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBacterial PH domain
Orthologous group2ESQF

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.647 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 12 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 10.21% of strains (14823) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
bPH_6PF10756.16 6.6e-2258–136 Bacterial PH domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: crgA (cell division protein CrgA), high confidence from genomic context alone (score 797 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0011c crgA cell division protein CrgA 903 797 ctx neighborhood:749 textmining:545
Rv3839 hyp hypothetical protein 764 764 ctx cooccurence:764
Rv3004 cfp6 low molecular weight protein antigen 6 740 740 ctx cooccurence:737
Rv2732c transmembrane protein 735 736 ctx cooccurence:734
Rv2171 lppM lipoprotein LppM 735 735 ctx cooccurence:734
Rv1100 hyp hypothetical protein 734 734 ctx cooccurence:733
Rv1109c hyp hypothetical protein 718 718 ctx cooccurence:717
Rv0431 tuberculin-like peptide 711 711 ctx cooccurence:709
Rv2843 hyp hypothetical protein 691 691 ctx cooccurence:691
Rv0013 trpG anthranilate synthase component II 674 674 ctx neighborhood:672
Rv1222 rseA anti-sigma E factor RseA 650 650 ctx cooccurence:648
Rv0012 membrane protein 648 649 ctx neighborhood:646
Rv0207c hyp hypothetical protein 648 648 ctx cooccurence:645
Rv2520c membrane protein 641 641 ctx cooccurence:638
Rv3909 hyp hypothetical protein 639 639 ctx cooccurence:637

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: PH domain-containing protein
  • Pfam (hmmscan --cut_ga): bPH_6 PF10756.16 (E=7e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214524.1)
  • Domains: Pfam-A via hmmscan --cut_ga — bPH_6 (PF10756.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ESQF
  • Curated reference: UniProt P9WMA3 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 78 functional partner(s); context anchor crgA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000014|Rv0010c|
MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAALGLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEIETVSGGLLILSRWDLGTDPVEVLDALTAAGYAGRGQR