ispE Resolved · high auto-curated

H37Rv Rv1011 · MTBC0 - · 306 aa · 1130191–1131111 (+) · RefSeq NP_215527.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)4-diphosphocytidyl-2C-methyl-D-erythritol kinase
MTBC0 PGAP re-annotation
Revised (this work)4-diphosphocytidyl-2C-methyl-D-erythritol kinase. Pfam: GHMP_kinases_N (PF00288.33), GHMP_kinases_C (PF08544.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WKG7 SwissProt · reviewed · Evidence at protein level
UniProt name4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
EC (curated) EC 2.7.1.148
Curated functionCatalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameispE
eggNOG descriptionCatalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol
Orthologous groupCOG1947
EC number EC 2.7.1.148
KEGG orthology K00919
KEGG pathways map00900, map01100, map01110, map01130
KEGG modules M00096
Gene Ontology (15) GO:0003674, GO:0003824, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0009987, GO:0016301, GO:0016310, GO:0016740, GO:0016772, GO:0016773 +3 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.569 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GHMP_kinases_NPF00288.33 5.0e-1870–148 GHMP kinases N terminal domain
GHMP_kinases_CPF08544.19 1.2e-09207–280 GHMP kinases C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ispF (2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase), high confidence from genomic context alone (score 978 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3581c ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 998 978 ctx cooccurence:756 database:900 textmining:956
Rv3582c ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 998 974 ctx cooccurence:730 database:900 textmining:949
Rv1010 ksgA rRNA small subunit methyltransferase A 990 932 ctx neighborhood:633 fusion:813 textmining:870
Rv2870c dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase 987 772 ctx cooccurence:758 textmining:948
Rv2868c gcpE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 983 755 ctx cooccurence:747 textmining:935
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 886 728 ctx cooccurence:718 textmining:600
Rv1012 hyp hypothetical protein 728 728 ctx neighborhood:727
Rv1013 pks16 polyketide synthase 739 726 ctx neighborhood:724
Rv3382c lytB1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 873 714 ctx cooccurence:705 textmining:577
Rv1009 rpfB resuscitation-promoting factor RpfB 804 638 ctx neighborhood:633 textmining:480
Rv2682c dxs1 1-deoxy-D-xylulose 5-phosphate synthase 937 590 ctx cooccurence:575 textmining:853
Rv3379c dxs2 1-deoxy-D-xylulose-5-phosphate synthase 835 529 ctx cooccurence:514 textmining:666
Rv1008 tatD deoxyribonuclease TatD 850 463 ctx neighborhood:461 textmining:733
Rv3923c rnpA ribonuclease P protein component 447 448 coexpression:403
Rv1292 argS arginine--tRNA ligase 438 438 coexpression:406

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  • Pfam (hmmscan --cut_ga): GHMP_kinases_N PF00288.33 (E=5e-18), GHMP_kinases_C PF08544.19 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215527.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GHMP_kinases_N (PF00288.33), GHMP_kinases_C (PF08544.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1947
  • Curated reference: UniProt P9WKG7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s); context anchor ispF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1011|ispE
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVSAPTEV