ddn Resolved · high auto-curated

H37Rv Rv3547 · MTBC0 mtbc0_003764 · 151 aa · 4010521–4010976 (+) · RefSeq NP_218064.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)deazaflavin-dependent nitroreductase
MTBC0 PGAP re-annotationdeazaflavin-dependent nitroreductase Ddn
Revised (this work)Deazaflavin-dependent nitroreductase Ddn. Pfam: F420H2_quin_red (PF04075.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP15 SwissProt · reviewed · Evidence at protein level
UniProt nameDeazaflavin-dependent nitroreductase
EC (curated) EC 1.-.-.-, EC 1.1.98.-
Curated functionInvolved in a F420-dependent anti-oxidant mechanism that protects M.tuberculosis against oxidative stress and bactericidal agents. Catalyzes the F420H(2)-dependent two-electron reduction of quinones to dihydroquinones, thereby preventing the formation of cytotoxic semiquinones obtained by the one-electron reduction pathway. In vitro, catalyzes the reduction of both benzoquinone and naphthoquinone analogs; since menaquinone is the sole quinone electron carrier in the respiratory chain in M.tuberculosis, the physiological electron acceptor for Fqr-mediated F420H(2) oxidation is therefore likely .

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameddn
eggNOG descriptionF420H(2)-dependent quinone reductase
Orthologous groupCOG0748
Gene Ontology (24) GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0008152, GO:0016020, GO:0030312, GO:0031406, GO:0036094 +12 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.203 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
F420H2_quin_redPF04075.21 5.1e-5822–151 F420H(2)-dependent quinone reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadA5 (acetyl-CoA acetyltransferase FadA), high confidence from genomic context alone (score 778 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3546 fadA5 acetyl-CoA acetyltransferase FadA 802 778 ctx neighborhood:766
Rv3261 fbiA 2-phospho-L-lactate transferase 976 768 ctx cooccurence:762 textmining:903
Rv3520c coenzyme F420-dependent oxidoreductase 781 768 ctx cooccurence:768
Rv0044c oxidoreductase 775 761 ctx cooccurence:761
Rv0407 fgd1 F420-dependent glucose-6-phosphate dehydrogenase 983 745 ctx cooccurence:745 textmining:936
Rv3262 fbiB coenzyme F420:L-glutamate ligase 974 745 ctx cooccurence:737 textmining:903
Rv2983 cofC 2-phospho-L-lactate guanylyltransferase 902 731 ctx cooccurence:723 textmining:651
Rv0132c fgd2 F420-dependent glucose-6-phosphate dehydrogenase 889 731 ctx cooccurence:731 textmining:605
Rv1855c oxidoreductase 730 713 ctx cooccurence:713
Rv3093c oxidoreductase 730 713 ctx cooccurence:713
Rv2951c phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase 720 703 ctx cooccurence:702
Rv1360 oxidoreductase 710 692 ctx cooccurence:692
Rv0791c hyp hypothetical protein 660 639 ctx cooccurence:637
Rv0331 dehydrogenase/reductase 651 636 database:583
Rv3072c hyp hypothetical protein 636 613 ctx cooccurence:613

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: deazaflavin-dependent nitroreductase
  • MTBC0 PGAP product: deazaflavin-dependent nitroreductase Ddn
  • Pfam (hmmscan --cut_ga): F420H2_quin_red PF04075.21 (E=5e-58)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218064.1)
  • Domains: Pfam-A via hmmscan --cut_ga — F420H2_quin_red (PF04075.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0748
  • Curated reference: UniProt P9WP15 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor fadA5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003764|Rv3547|ddn
MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP