cofC Resolved · high auto-curated
H37Rv Rv2983 · MTBC0 mtbc0_003168 ·
214 aa ·
3360427–3361071 MTBC0
(+) ·
RefSeq NP_217499.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 2-phospho-L-lactate guanylyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | 2-phospho-L-lactate guanylyltransferase |
| Revised (this work) | 2-phospho-L-lactate guanylyltransferase. Pfam: CofC (PF01983.22), NTP_transf_3 (PF12804.14). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Delamanid or pretomanid for treatment of multidrug resistant tuberculosis---spoilt for choice? doi:10.1016/j.ijtb.2025.09.005 | 2026 |
| Mutations in fbiD (Rv2983) as a Novel Determinant of Resistance to Pretomanid and Delamanid in Mycobacterium tuberculosis. doi:10.1128/AAC.01948-20 | 2020 |
| Mycobacterium smegmatis mc2 155 fbiC and MSMEG_2392 are involved in triphenylmethane dye decolorization and coenzyme F420 biosynthesis. doi:10.1099/mic.0.2006/009241-0 | 2007 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -0.16 (95% CI -1.02 to 1.03). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3007
· 100.0% identity |
|---|---|
| M. leprae |
ML1680
· 79.1% identity |
| M. marinum |
MMAR_1731
· 80.9% identity |
| M. smegmatis |
MSMEG_2392
· 65.9% identity |
| M. orygis |
RJtmp_003078
· 100.0% identity |
| M. abscessus |
MAB_3289
· 54.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WP83
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoenolpyruvate guanylyltransferase |
| EC (curated) |
EC 2.7.7.105
|
| Curated function | Guanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with GTP. It is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | cofC |
| eggNOG description | Guanylyltransferase that catalyzes the activation of 2- phospho-L-lactate (LP) as (2S)-lactyl-2-diphospho-5'-guanosine (LPPG), via the condensation of LP with GTP. Is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor |
| Orthologous group | COG1920 |
| EC number |
EC 2.7.7.68
|
| KEGG orthology |
K14941
|
| KEGG pathways |
map00680, map01120
|
| KEGG modules |
M00378
|
| Gene Ontology (17) |
GO:0003674, GO:0003824, GO:0006732, GO:0008150, GO:0008152, GO:0009058, GO:0009108, GO:0009987, GO:0016740, GO:0016772, GO:0016779, GO:0043814 +5 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.39 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 79.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 45.9% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 6 in the ORF — 0 in the essential state, 3 growth-defect, 3 non-essential, 0 growth-advantage. Saturation 0.833, mean read count 14.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +3.96 | 0.039 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Drug resistance (WHO catalogue) delamanid
| delamanid | 39 catalogued resistance-associated variant(s) |
|---|
This gene carries mutations classed Associated with resistance (WHO grade 1–2) in the consolidated catalogue (WHO 2nd ed. 2023 + tb-profiler). Only the R-associated tier is shown; "uncertain" and empirical-only signals are excluded. Test a specific strain or variant with the resistance tester. Research context, not a clinical diagnostic.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 10.7 ppm · rank 2648/3519 (24.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 214 aa |
|---|---|
| Molecular weight | 21.8 kDa |
| Theoretical pI | 5.49 |
| GRAVY | 0.126 (hydrophobic) |
| Aliphatic index | 97.3 |
| Aromaticity | 0.023 |
| Instability index | 32.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CofC | PF01983.22 | 1.7e-12 | 12–166 | Guanylyl transferase CofC like |
NTP_transf_3 | PF12804.14 | 2.7e-08 | 42–160 | MobA-like NTP transferase domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
6bwg |
X-ray diffraction | 1.99 Å | 99% |
6bwh |
X-ray diffraction | 2.18 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6bwg-assembly1_A |
1.00 | 1.00 | 9.6e-41 sig | 6bwg-assembly1_A Crystal structure of native Rv2983 from Mycobacterium tuberculosis |
6bwg-assembly2_B |
1.00 | 0.99 | 4.0e-38 sig | 6bwg-assembly2_B Crystal structure of native Rv2983 from Mycobacterium tuberculosis |
6bwh-assembly3_C |
1.00 | 0.99 | 1.7e-36 sig | 6bwh-assembly3_C Crystal structure of Mycoibacterium tuberculosis Rv2983 in complex with PEP |
7p97-assembly2_BBB |
1.00 | 0.82 | 1.6e-14 sig | 7p97-assembly2_BBB Structure of 3-phospho-D-glycerate guanylyltransferase with product 3-GPPG bound |
3cgx-assembly1_A |
1.00 | 0.66 | 1.5e-08 sig | 3cgx-assembly1_A Crystal structure of putative nucleotide-diphospho-sugar transferase (YP_389115.1) from Desulfovibrio desulfuricans G20 at 1.90 A resolution |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | gpdA2 (- strand, 118 bp gap) |
|---|---|
| Downstream (3' on genome) | ppk1 (+ strand, 91 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv3488 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: fbiA (2-phospho-L-lactate transferase), high confidence from genomic context alone (score 979 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3261 fbiA exp |
2-phospho-L-lactate transferase | 998 | 979 ctx | cooccurence:773 database:900 textmining:948 |
Rv3262 fbiB |
coenzyme F420:L-glutamate ligase | 992 | 784 ctx | cooccurence:742 textmining:965 |
Rv2984 ppk1 |
polyphosphate kinase | 779 | 779 ctx | neighborhood:777 |
Rv3547 ddn |
deazaflavin-dependent nitroreductase | 902 | 731 ctx | cooccurence:723 textmining:651 |
Rv1261c hyp |
hypothetical protein | 774 | 726 ctx | cooccurence:722 |
Rv0132c fgd2 |
F420-dependent glucose-6-phosphate dehydrogenase | 795 | 712 ctx | cooccurence:700 |
Rv3178 |
nitroreductase | 740 | 709 ctx | cooccurence:700 |
Rv1558 hyp |
hypothetical protein | 773 | 702 ctx | cooccurence:694 |
Rv0407 fgd1 |
F420-dependent glucose-6-phosphate dehydrogenase | 970 | 689 ctx | cooccurence:677 textmining:909 |
Rv2951c |
phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase | 699 | 668 ctx | cooccurence:657 |
Rv2985 mutT1 |
8-oxo-dGTP diphosphatase | 653 | 654 ctx | neighborhood:654 |
Rv2982c gpdA2 |
glycerol-3-phosphate dehydrogenase | 634 | 635 ctx | neighborhood:628 |
Rv1855c |
oxidoreductase | 650 | 614 ctx | cooccurence:600 |
Rv1173 fbiC |
FO synthase | 978 | 609 ctx | cooccurence:560 textmining:948 |
Rv0044c |
oxidoreductase | 637 | 600 ctx | cooccurence:584 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 2-phospho-L-lactate guanylyltransferase
- MTBC0 PGAP product: 2-phospho-L-lactate guanylyltransferase
- Pfam (hmmscan --cut_ga): CofC PF01983.22 (E=2e-12), NTP_transf_3 PF12804.14 (E=3e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217499.1)
- Domains: Pfam-A via hmmscan --cut_ga — CofC (PF01983.22), NTP_transf_3 (PF12804.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1920 - Curated reference: UniProt P9WP83 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
fbiA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Drug resistance: consolidated catalogue, WHO 2nd ed. 2023 (9789240082410) + tb-profiler; only the resistance-associated tier (grade 1–2) is surfaced
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003168|Rv2983|cofC MSGTPDDGDIGLIIAVKRLAAAKTRLAPVFSAQTRENVVLAMLVDTLTAAAGVGSLRSITVITPDEAAAAAAAGLGADVLADPTPEDDPDPLNTAITAAERVVAEGASNIVVLQGDLPALQTQELAEAISAARHHRRSFVADRLGTGTAVLCAFGTALHPRFGPDSSARHRRSGAVELTGAWPGLRCDVDTPADLTAARQLGVGPATARAVAHR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cofC? Email the maintainer — the message is pre-filled with this gene's details.