cofC Resolved · high auto-curated

H37Rv Rv2983 · MTBC0 mtbc0_003168 · 214 aa · 3360427–3361071 (+) · RefSeq NP_217499.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)2-phospho-L-lactate guanylyltransferase
MTBC0 PGAP re-annotation2-phospho-L-lactate guanylyltransferase
Revised (this work)2-phospho-L-lactate guanylyltransferase. Pfam: CofC (PF01983.22), NTP_transf_3 (PF12804.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP83 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphoenolpyruvate guanylyltransferase
EC (curated) EC 2.7.7.105
Curated functionGuanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with GTP. It is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecofC
eggNOG descriptionGuanylyltransferase that catalyzes the activation of 2- phospho-L-lactate (LP) as (2S)-lactyl-2-diphospho-5'-guanosine (LPPG), via the condensation of LP with GTP. Is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor
Orthologous groupCOG1920
EC number EC 2.7.7.68
KEGG orthology K14941
KEGG pathways map00680, map01120
KEGG modules M00378
Gene Ontology (17) GO:0003674, GO:0003824, GO:0006732, GO:0008150, GO:0008152, GO:0009058, GO:0009108, GO:0009987, GO:0016740, GO:0016772, GO:0016779, GO:0043814 +5 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.39 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CofCPF01983.22 1.7e-1212–166 Guanylyl transferase CofC like
NTP_transf_3PF12804.14 2.7e-0842–160 MobA-like NTP transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fbiA (2-phospho-L-lactate transferase), high confidence from genomic context alone (score 979 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3261 fbiA 2-phospho-L-lactate transferase 998 979 ctx cooccurence:773 database:900 textmining:948
Rv3262 fbiB coenzyme F420:L-glutamate ligase 992 784 ctx cooccurence:742 textmining:965
Rv2984 ppk1 polyphosphate kinase 779 779 ctx neighborhood:777
Rv3547 ddn deazaflavin-dependent nitroreductase 902 731 ctx cooccurence:723 textmining:651
Rv1261c hyp hypothetical protein 774 726 ctx cooccurence:722
Rv0132c fgd2 F420-dependent glucose-6-phosphate dehydrogenase 795 712 ctx cooccurence:700
Rv3178 nitroreductase 740 709 ctx cooccurence:700
Rv1558 hyp hypothetical protein 773 702 ctx cooccurence:694
Rv0407 fgd1 F420-dependent glucose-6-phosphate dehydrogenase 970 689 ctx cooccurence:677 textmining:909
Rv2951c phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase 699 668 ctx cooccurence:657
Rv2985 mutT1 8-oxo-dGTP diphosphatase 653 654 ctx neighborhood:654
Rv2982c gpdA2 glycerol-3-phosphate dehydrogenase 634 635 ctx neighborhood:628
Rv1855c oxidoreductase 650 614 ctx cooccurence:600
Rv1173 fbiC FO synthase 978 609 ctx cooccurence:560 textmining:948
Rv0044c oxidoreductase 637 600 ctx cooccurence:584

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 2-phospho-L-lactate guanylyltransferase
  • MTBC0 PGAP product: 2-phospho-L-lactate guanylyltransferase
  • Pfam (hmmscan --cut_ga): CofC PF01983.22 (E=2e-12), NTP_transf_3 PF12804.14 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217499.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CofC (PF01983.22), NTP_transf_3 (PF12804.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1920
  • Curated reference: UniProt P9WP83 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor fbiA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003168|Rv2983|cofC
MSGTPDDGDIGLIIAVKRLAAAKTRLAPVFSAQTRENVVLAMLVDTLTAAAGVGSLRSITVITPDEAAAAAAAGLGADVLADPTPEDDPDPLNTAITAAERVVAEGASNIVVLQGDLPALQTQELAEAISAARHHRRSFVADRLGTGTAVLCAFGTALHPRFGPDSSARHRRSGAVELTGAWPGLRCDVDTPADLTAARQLGVGPATARAVAHR