ltp2 Resolved · high auto-curated
H37Rv Rv3540c · MTBC0 mtbc0_003757 ·
386 aa ·
4003176–4004336 MTBC0
(-) ·
RefSeq NP_218057.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipid transfer protein |
|---|---|
| MTBC0 PGAP re-annotation | lipid-transfer protein |
| Revised (this work) | Lipid-transfer protein. Pfam: Thiolase_N (PF00108.30), Thiolase_C_1 (PF22691.3). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Identification of dehydrogenase, hydratase, and aldolase responsible for the propionyl residue removal in degradation of cholic acid C-17 side chain in Comamonas testosteroni TA441. doi:10.1128/spectrum.00308-25 | 2025 |
| Mycobacterium tuberculosis Exploits a Heterohexameric Enoyl-CoA Hydratase Retro-Aldolase Complex for Cholesterol Catabolism. doi:10.1021/acs.biochem.9b00673 | 2019 |
| The steroid side-chain-cleaving aldolase Ltp2-ChsH2DUF35 is a thiolase superfamily member with a radically repurposed active site. doi:10.1074/jbc.RA119.008889 | 2019 |
| Characterization of an Aldolase Involved in Cholesterol Side Chain Degradation in Mycobacterium tuberculosis. doi:10.1128/JB.00512-17 | 2018 |
| Comparative analysis of genes encoding key steroid core oxidation enzymes in fast-growing Mycobacterium spp. strains. doi:10.1016/j.jsbmb.2013.02.016 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv3541c (Rv3541c, - strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.88 (95% CI -1.81 to 4.71). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown, supposed involvement in lipid metabolism. |
|---|---|
| Mycobrowser EC |
2.3.1.16
· differs from the atlas (4.1.3.-) — cholesterol-catabolism lyase Ltp2 (EC 4.1.3.-, UniProt); Mycobrowser's thiolase 2.3.1.16 is obsolete
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3570c
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_5027
· 93.3% identity |
| M. smegmatis |
MSMEG_5990
· 84.7% identity |
| M. orygis |
RJtmp_003646
· 99.7% identity |
| M. abscessus |
MAB_0618
· 82.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6Y3T7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 17-hydroxy-3-oxo-4-pregnene-20-carboxyl-CoA lyase |
| EC (curated) |
EC 4.1.3.-
|
| Curated function | Involved in cholesterol side chain degradation. When associated with the ChsH1/ChsH2 hydratase, catalyzes the retroaldol cleavage of 17-hydroxy-3-oxo-4-pregnene-20-carboxyl-CoA (17-HOPC-CoA) produced by the hydratase, forming androst-4-ene-3,17-dione and propionyl-CoA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | ltp2 |
| eggNOG description | lipid-transfer protein |
| Orthologous group | COG0183 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.208 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 90.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 77.5% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) cholesterol-required
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 19 in the ORF — 0 in the essential state, 0 growth-defect, 19 non-essential, 0 growth-advantage. Saturation 0.842, mean read count 36.0625. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Cholesterol catabolism | required for growth on cholesterol (Griffin 2011) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -8.84 | 0.0068 | required |
| fitness on cholesterol (vs glycerol) (carbon source) | -5.47 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.06 | 0.012 | required |
| fitness in mouse infection, day 45 (in vivo) | -3.48 | 0.0086 | required |
Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 6.66 ppm · rank 2840/3519 (19.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 386 aa |
|---|---|
| Molecular weight | 40.6 kDa |
| Theoretical pI | 5.37 |
| GRAVY | 0.013 (hydrophobic) |
| Aliphatic index | 86.3 |
| Aromaticity | 0.067 |
| Instability index | 31.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Thiolase_N | PF00108.30 | 1.1e-06 | 8–227 | Thiolase, N-terminal domain |
Thiolase_C_1 | PF22691.3 | 8.6e-29 | 271–378 | Thiolase C-terminal domain-like |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6ok1-assembly1_C |
1.00 | 0.98 | 3.7e-62 sig | 6ok1-assembly1_C Ltp2-ChsH2(DUF35) aldolase |
6ok1-assembly1_A |
1.00 | 0.98 | 6.9e-61 sig | 6ok1-assembly1_A Ltp2-ChsH2(DUF35) aldolase |
4u4e-assembly1_A |
1.00 | 0.91 | 4.1e-31 sig | 4u4e-assembly1_A Crystal structure of putative thiolase from Sphaerobacter thermophilus DSM 20745 |
7yvy-assembly1_A |
1.00 | 0.87 | 8.5e-30 sig | 7yvy-assembly1_A Crystal structure of thiolase PFC_04095 from Pyrococcus furiosus |
7yvy-assembly3_C |
1.00 | 0.90 | 1.0e-27 sig | 7yvy-assembly3_C Crystal structure of thiolase PFC_04095 from Pyrococcus furiosus |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 6
| Upstream (5' on genome) | PPE63 (+ strand, 0 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3541c (- strand, -1 bp gap) |
| Predicted operon |
ltp2 · Rv3541c · Rv3542c · fadE29 · fadE28 · cyp125
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (4 TF) |
Rv0081 (activates) · Rv0324 (activates) · Rv0681 (activates) · Rv1353c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: fadE29 (acyl-CoA dehydrogenase FadE29), high confidence from genomic context alone (score 980 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3542c chsH2 hyp exp |
hypothetical protein | 999 | 999 ctx | neighborhood:882 cooccurence:761 coexpression:866 experimental:508 database:500 |
Rv3541c chsH1 hyp exp |
hypothetical protein | 999 | 998 ctx | neighborhood:882 cooccurence:730 coexpression:857 database:500 textmining:809 |
Rv3543c fadE29 |
acyl-CoA dehydrogenase FadE29 | 998 | 980 ctx | neighborhood:881 cooccurence:602 coexpression:577 textmining:907 |
Rv0860 fadB exp |
fatty oxidation protein FadB | 969 | 966 | coexpression:697 experimental:804 database:447 |
Rv3544c fadE28 |
acyl-CoA dehydrogenase FadE28 | 995 | 962 ctx | neighborhood:881 cooccurence:476 textmining:878 |
Rv3521 hyp exp |
hypothetical protein | 916 | 895 ctx | cooccurence:706 coexpression:424 experimental:415 |
Rv3550 echA20 exp |
enoyl-CoA hydratase EchA20 | 907 | 877 ctx | cooccurence:526 database:447 |
Rv3545c cyp125 |
steroid C26-monooxygenase | 980 | 865 ctx | neighborhood:836 textmining:865 |
Rv3562 fadE31 |
acyl-CoA dehydrogenase FadE31 | 843 | 834 ctx | cooccurence:716 |
Rv3560c fadE30 |
acyl-CoA dehydrogenase FadE30 | 915 | 826 ctx | cooccurence:701 textmining:535 |
Rv3537 kstD exp |
3-oxosteroid 1-dehydrogenase | 848 | 815 ctx | cooccurence:546 database:500 |
Rv3551 |
CoA-transferase subunit alpha | 846 | 805 ctx | cooccurence:753 |
Rv3552 |
CoA-transferase subunit beta | 813 | 805 ctx | cooccurence:750 |
Rv3516 echA19 exp |
enoyl-CoA hydratase EchA19 | 859 | 785 | database:447 |
Rv3573c fadE34 |
acyl-CoA dehydrogenase FadE34 | 924 | 783 ctx | cooccurence:628 textmining:668 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipid transfer protein
- MTBC0 PGAP product: lipid-transfer protein
- Pfam (hmmscan --cut_ga): Thiolase_N PF00108.30 (E=1e-06), Thiolase_C_1 PF22691.3 (E=9e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218057.1)
- Domains: Pfam-A via hmmscan --cut_ga — Thiolase_N (PF00108.30), Thiolase_C_1 (PF22691.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0183 - Curated reference: UniProt I6Y3T7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
124 functional partner(s); context anchor
fadE29 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003757|Rv3540c|ltp2 MLSGQAAIVGIGATDFSKNSGRSELRLAAEAVLDALADAGLSPTDVDGLTTFTMDTNTEIAVARAAGIGELTFFSKIHYGGGAACATVQHAAMAVATGVADVVVAYRAFNERSGMRFGQVQTRLTENADSTGVDNSFSYPHGLSTPAAQVAMIARRYMHLSGATSRDFGAVSVADRKHAANNPKAYFYGKPITIEDHQNSRWIAEPLRLLDCCQETDGAVAIVVTSAARARDLKQRPVVIEAAAQGCSPDQYTMVSYYRPELDGLPEMGLVGRQLWAQSGLTPADVQTAVLYDHFTPFTLIQLEELGFCGKGEAKDFIADGAIEVGGRLPINTHGGQLGEAYIHGMNGIAEGVRQLRGTSVNPVAGVEHVLVTAGTGVPTSGLILG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ltp2? Email the maintainer — the message is pre-filled with this gene's details.