Rv3072c Family assigned · medium auto-curated

H37Rv Rv3072c · MTBC0 - · 174 aa · 3435798–3436322 (-) · RefSeq NP_217588.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Bac_luciferase (PF00296.27) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P95086 TrEMBL · unreviewed · Predicted
UniProt nameLuciferase-like domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionF420-dependent oxidoreductase, Rv2161c
Orthologous groupCOG2141

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.921 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_luciferasePF00296.27 1.7e-1715–133 Luciferase-like monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2893 (oxidoreductase), high confidence from genomic context alone (score 730 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3073c hyp hypothetical protein 818 818 ctx neighborhood:817
Rv0791c hyp hypothetical protein 756 743 ctx cooccurence:743
Rv2893 oxidoreductase 743 730 ctx cooccurence:728
Rv0940c oxidoreductase 722 722 ctx cooccurence:722
Rv3093c oxidoreductase 705 705 ctx cooccurence:703
Rv2951c phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase 706 691 ctx cooccurence:690
Rv1855c oxidoreductase 690 690 ctx cooccurence:690
Rv0132c fgd2 F420-dependent glucose-6-phosphate dehydrogenase 688 689 ctx cooccurence:688
Rv3178 nitroreductase 659 638 ctx cooccurence:638
Rv3520c coenzyme F420-dependent oxidoreductase 622 623 ctx cooccurence:609
Rv3547 ddn deazaflavin-dependent nitroreductase 636 613 ctx cooccurence:613
Rv1261c hyp hypothetical protein 599 599 ctx cooccurence:598
Rv3262 fbiB coenzyme F420:L-glutamate ligase 631 593 ctx cooccurence:541
Rv3074 hyp hypothetical protein 584 584 ctx neighborhood:580
Rv0044c oxidoreductase 570 570 ctx cooccurence:570

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217588.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2141
  • Curated reference: UniProt P95086 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv2893
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3072c|
MACVRRSCDVTGTARAGIGAGADPAVVDAVAVAADDCGFATLWVGEHVVMVDRPASRYPYSRDGVIAVPAQADWLDPMIALSFAAAASSRVDVATGVLLLPEHNPVIVAKEAASLDRLSGRRLTLGVASDGPRRSSTRSECHSSGAQSAPPNTSLQCAHYGATTSHRSTATVGS