Rv3528c Family assigned · low auto-curated · to review

H37Rv Rv3528c · MTBC0 mtbc0_003744 · 237 aa · 3988156–3988869 (-) · RefSeq NP_218045.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 7pga-assembly2_D Chimeric carminomycin-4-O-methyltransferase (DnrK) with regions (prob 1.00, TM 0.55). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt I6YGE4 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMethyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group290BN

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.507 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 2 nonsense, 2 frameshift
Disruption 4 distinct premature-stop/frameshift site(s); most common in 0.32% of strains (467) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.5 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7pga-assembly2_D 1.00 0.55 1.0e-09 sig 7pga-assembly2_D Chimeric carminomycin-4-O-methyltransferase (DnrK) with regions from 10-hydroxylase RdmB and 10-decarboxylase TamK
7d8d-assembly1_A 1.00 0.58 2.2e-08 sig 7d8d-assembly1_A The crystal structure of ScNTM1 in complex with SAH and Rps25a hexapeptide
5ufm-assembly1_A 1.00 0.59 1.8e-08 sig 5ufm-assembly1_A Crystal structure of Burkholderia thailandensis 1,6-didemethyltoxoflavin-N1-methyltransferase with bound 1,6-didemethyltoxoflavin and S-adenosylhomocysteine
5jr3-assembly1_A 1.00 0.55 5.1e-09 sig 5jr3-assembly1_A Crystal structure of carminomycin-4-O-methyltransferase DnrK in complex with SAH and 4-methylumbelliferone
7pga-assembly1_A 1.00 0.49 3.1e-09 sig 7pga-assembly1_A Chimeric carminomycin-4-O-methyltransferase (DnrK) with regions from 10-hydroxylase RdmB and 10-decarboxylase TamK
5eeg-assembly1_A 1.00 0.54 4.5e-08 sig 5eeg-assembly1_A Crystal structure of carminomycin-4-O-methyltransferase DnrK in complex with tetrazole-SAH
9j56-assembly1_A 1.00 0.55 4.2e-08 sig 9j56-assembly1_A Functional Investigation of the SAM-Dependent Methyltransferases Rdmb in Anthracycline Biosynthesis
9fcs-assembly2_B 1.00 0.62 1.9e-07 sig 9fcs-assembly2_B CysG(N-16)-H122N mutant in complex with SAH from Kitasatospora cystarginea

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3779 transmembrane protein 553 50 textmining:549
Rv0495c hyp hypothetical protein 440 50 textmining:435
Rv3527 hyp hypothetical protein 441 47 textmining:438
Rv1084 hyp hypothetical protein 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7pga-assembly2_D Chimeric carminomycin-4-O-methyltransferase (DnrK) with regions (prob 1.00, E=1e-09, TM=0.55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218045.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 290BN
  • Curated reference: UniProt I6YGE4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.5, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003744|Rv3528c|
MMLDRLRQGGYWLVRGKINLIDRAFTSCRIESFADLGAVWGVEGAYTFRALDKYPVKEAVLVDGRITPTVAARANSYPQLRVIEGNFGDQEIADKVGNVDALFLFDVLLHQVSPDWDTILDMYAKNVRCLLIYNQQWIGSTTTVRLLDLGEKHYFRNVPHSKLNKAYRDLFQKLDKKHPDHDKPWRDIPDIWQWGITDADLESKASELGFKLLYKEDCRGFGWLPNIQNRAFLFARQ