Rv0073 Family assigned · medium auto-curated

H37Rv Rv0073 · MTBC0 mtbc0_000081 · 330 aa · 81839–82831 (+) · RefSeq NP_214587.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamine ABC transporter ATP-binding protein
MTBC0 PGAP re-annotationATP-binding cassette domain-containing protein
Revised (this work)ATP-binding cassette domain-containing protein. Pfam: ABC_tran (PF00005.34), cNMP_binding (PF00027.36).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQK5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized ABC transporter ATP-binding protein Rv0073
Curated functionProbably part of an ABC transporter complex. Probably responsible for energy coupling to the transport system (By similarity).

UniProt still lists this protein as Uncharacterized ABC transporter ATP-binding protein Rv0073; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionABC transporter
Orthologous groupCOG0664
KEGG orthology K02003
KEGG modules M00258

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.232 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 4 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 5.29% of strains (7679) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 9.2e-3524–172 ABC transporter
cNMP_bindingPF00027.36 7.7e-19229–311 Cyclic nucleotide-binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0072 (glutamine ABC transporter permease), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0072 glutamine ABC transporter permease 999 1000 ctx neighborhood:882 cooccurence:423 coexpression:885 experimental:773 database:900
Rv2563 glutamine ABC transporter permease 931 925 ctx cooccurence:410 coexpression:448 experimental:773
Rv0074 hyp hypothetical protein 676 664 ctx neighborhood:605
Rv3580c cysS1 cysteine--tRNA ligase 652 639 ctx cooccurence:519
Rv0075 aminotransferase 652 636 ctx neighborhood:553
Rv3419c gcp O-sialoglycoprotein endopeptidase 617 617 ctx cooccurence:570
Rv0386 transcriptional regulator 643 600 experimental:447
Rv2488c LuxR family transcriptional regulator 643 600 experimental:447
Rv1358 transcriptional regulator 643 600 experimental:447
Rv2048c pks12 polyketide synthase 691 587 database:431
Rv3485c short-chain type dehydrogenase/reductase 605 587 database:431
Rv2940c mas multifunctional mycocerosic acid synthase 691 586 database:431
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 689 584 database:431
Rv1527c pks5 polyketide synthase 689 584 database:431
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 688 583 database:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamine ABC transporter ATP-binding protein
  • MTBC0 PGAP product: ATP-binding cassette domain-containing protein
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=9e-35), cNMP_binding PF00027.36 (E=8e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214587.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), cNMP_binding (PF00027.36)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0664
  • Curated reference: UniProt P9WQK5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 114 functional partner(s); context anchor Rv0072
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000081|Rv0073|
MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCGKTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVENVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPPLILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAETNRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEIGVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND