Rv0073 Family assigned · medium auto-curated
H37Rv Rv0073 · MTBC0 mtbc0_000081 ·
330 aa · 81839–82831 (+) ·
RefSeq NP_214587.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glutamine ABC transporter ATP-binding protein |
|---|---|
| MTBC0 PGAP re-annotation | ATP-binding cassette domain-containing protein |
| Revised (this work) | ATP-binding cassette domain-containing protein. Pfam: ABC_tran (PF00005.34), cNMP_binding (PF00027.36). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQK5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized ABC transporter ATP-binding protein Rv0073 |
| Curated function | Probably part of an ABC transporter complex. Probably responsible for energy coupling to the transport system (By similarity). |
UniProt still lists this protein as Uncharacterized ABC transporter ATP-binding protein Rv0073; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| eggNOG description | ABC transporter |
| Orthologous group | COG0664 |
| KEGG orthology |
K02003
|
| KEGG modules |
M00258
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.232 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 4 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 5.29% of strains (7679) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC_tran | PF00005.34 | 9.2e-35 | 24–172 | ABC transporter |
cNMP_binding | PF00027.36 | 7.7e-19 | 229–311 | Cyclic nucleotide-binding domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0072 (glutamine ABC transporter permease), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0072 |
glutamine ABC transporter permease | 999 | 1000 ctx | neighborhood:882 cooccurence:423 coexpression:885 experimental:773 database:900 |
Rv2563 |
glutamine ABC transporter permease | 931 | 925 ctx | cooccurence:410 coexpression:448 experimental:773 |
Rv0074 hyp |
hypothetical protein | 676 | 664 ctx | neighborhood:605 |
Rv3580c cysS1 |
cysteine--tRNA ligase | 652 | 639 ctx | cooccurence:519 |
Rv0075 |
aminotransferase | 652 | 636 ctx | neighborhood:553 |
Rv3419c gcp |
O-sialoglycoprotein endopeptidase | 617 | 617 ctx | cooccurence:570 |
Rv0386 |
transcriptional regulator | 643 | 600 | experimental:447 |
Rv2488c |
LuxR family transcriptional regulator | 643 | 600 | experimental:447 |
Rv1358 |
transcriptional regulator | 643 | 600 | experimental:447 |
Rv2048c pks12 |
polyketide synthase | 691 | 587 | database:431 |
Rv3485c |
short-chain type dehydrogenase/reductase | 605 | 587 | database:431 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 691 | 586 | database:431 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 689 | 584 | database:431 |
Rv1527c pks5 |
polyketide synthase | 689 | 584 | database:431 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 688 | 583 | database:431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glutamine ABC transporter ATP-binding protein
- MTBC0 PGAP product: ATP-binding cassette domain-containing protein
- Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=9e-35), cNMP_binding PF00027.36 (E=8e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214587.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), cNMP_binding (PF00027.36)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0664 - Curated reference: UniProt P9WQK5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
114 functional partner(s); context anchor
Rv0072 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000081|Rv0073| MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCGKTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVENVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPPLILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAETNRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEIGVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND