Rv0090 Still unknown · low auto-curated

H37Rv Rv0090 · MTBC0 mtbc0_000100 · 256 aa · 98643–99413 (+) · RefSeq NP_214604.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF2127 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF2127. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM71 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0090

UniProt still lists this protein as Uncharacterized protein Rv0090; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPredicted membrane protein (DUF2127)
Orthologous groupCOG3305

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.903 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 0.67% of strains (977) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2127PF09900.15 2.0e-3383–224 Predicted membrane protein (DUF2127)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0180c (transmembrane protein), medium confidence from genomic context alone (score 687 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2577 hyp hypothetical protein 728 728 ctx cooccurence:713
Rv0180c transmembrane protein 686 687 ctx cooccurence:685
Rv2963 integral membrane protein 668 668 ctx cooccurence:665
Rv3310 sapM acid phosphatase 649 649 ctx cooccurence:649
Rv0089 methyltransferase 622 623 ctx neighborhood:581
Rv1619 hyp hypothetical protein 565 565 ctx cooccurence:565
Rv1006 hyp hypothetical protein 550 550 ctx cooccurence:550
Rv3434c transmembrane protein 535 535 ctx cooccurence:535
Rv2314c hyp hypothetical protein 531 531 ctx cooccurence:531
Rv3484 cpsA hyp hypothetical protein 503 503 ctx cooccurence:503
Rv1762c hyp hypothetical protein 485 485 ctx cooccurence:483
Rv1435c hyp hypothetical protein 473 473 ctx cooccurence:473
Rv0219 transmembrane protein 447 447 ctx cooccurence:430
Rv0088 polyketide cyclase/dehydrase 429 429
Rv1639c hyp hypothetical protein 419 419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF2127 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF2127 PF09900.15 (E=2e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214604.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2127 (PF09900.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3305
  • Curated reference: UniProt P9WM71 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv0180c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000100|Rv0090|
MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEVWRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAVWEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYAVLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLLISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT