pgsA1 Resolved · high auto-curated

H37Rv Rv2612c · MTBC0 - · 217 aa · 2939959–2940612 (-) · RefSeq YP_177894.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)CDP-diacylglycerol--inositol 3-phosphatidyltransferase
MTBC0 PGAP re-annotation
Revised (this work)CDP-diacylglycerol--inositol 3-phosphatidyltransferase. Pfam: CDP-OH_P_transf (PF01066.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WPG7 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphatidylinositol phosphate synthase
EC (curated) EC 2.7.8.-
Curated functionCatalyzes the conjugation of the 1'-hydroxyl group of D-myo-inositol-3-phosphate (also named L-myo-inositol-1-phosphate) with a lipid tail of cytidine diphosphate diacylglycerol (CDP-DAG), forming phosphatidylinositol phosphate (PIP) and CMP. PIP is a precursor of phosphatidylinositol (PI) which is an essential lipid for mycobacteria required for formation of their cell wall.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namepgsA1
eggNOG descriptionBelongs to the CDP-alcohol phosphatidyltransferase class-I family
Orthologous groupCOG0558
EC number EC 2.7.8.11, EC 2.7.8.5
KEGG orthology K00995, K00999
KEGG pathways map00562, map00564, map01100, map04070
Gene Ontology (40) GO:0003674, GO:0003824, GO:0003881, GO:0003882, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0006629, GO:0006644, GO:0006650 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CDP-OH_P_transfPF01066.27 4.5e-1229–135 CDP-alcohol phosphatidyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2611c (phosphatidylinositol mannoside acyltransferase), high confidence from genomic context alone (score 969 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2611c phosphatidylinositol mannoside acyltransferase 992 969 ctx neighborhood:882 fusion:463 cooccurence:448 textmining:753
Rv2610c pimA alpha-(1-2)-phosphatidylinositol mannosyltransferase 963 952 ctx neighborhood:879 cooccurence:510
Rv2613c AP-4-A phosphorylase 964 922 ctx neighborhood:882 textmining:565
Rv1822 pgsA2 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 981 914 database:900 textmining:793
Rv0436c pssA CDP-diacylglycerol--serine O-phosphatidyltransferase 971 906 database:900 textmining:708
Rv2881c cdsA phosphatidate cytidylyltransferase 958 906 database:900 textmining:582
Rv2289 cdh CDP-diacylglycerol pyrophosphatase 900 901 database:900
Rv2746c pgsA3 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 987 900 database:900 textmining:876
Rv2614c thrS threonine--tRNA ligase 929 888 ctx neighborhood:881 textmining:400
Rv0046c ino1 inositol-3-phosphate synthase 896 861 ctx cooccurence:712 database:500
Rv2609c membrane protein 884 814 ctx neighborhood:798 textmining:402
Rv1901 cinA competence damage-inducible protein CinA 823 769 coexpression:736
Rv2614A hyp hypothetical protein 552 553 ctx neighborhood:550
Rv2606c snzP pyridoxine biosynthesis protein 506 507 ctx neighborhood:498
Rv3310 sapM acid phosphatase 499 500 database:500

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): CDP-diacylglycerol--inositol 3-phosphatidyltransferase
  • Pfam (hmmscan --cut_ga): CDP-OH_P_transf PF01066.27 (E=4e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177894.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CDP-OH_P_transf (PF01066.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0558
  • Curated reference: UniProt P9WPG7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv2611c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2612c|pgsA1
MSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDRPLVIATLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPPALSVGMWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR