clpP2 Family assigned · medium auto-curated

H37Rv Rv2460c · MTBC0 mtbc0_002619 · 214 aa · 2786779–2787423 (-) · RefSeq NP_216976.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP-dependent CLP protease proteolytic subunit 2
MTBC0 PGAP re-annotationATP-dependent CLP protease proteolytic subunit ClpP2
Revised (this work)ATP-dependent CLP protease proteolytic subunit ClpP2. Pfam: CLP_protease (PF00574.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPC3 SwissProt · reviewed · Evidence at protein level
UniProt nameATP-dependent Clp protease proteolytic subunit 2
EC (curated) EC 3.4.21.92
Curated functionCleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Degrades anti-sigma-D factor RsdA when present in a complex with ClpP1 and ClpX. Degrades anti-sigma-E factor RseA in the presence of ClpC1. Does not seem to act on anti-sigma-L factor RslA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameclpP
eggNOG descriptionCleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins
Orthologous groupCOG0740
EC number EC 3.4.21.92
KEGG orthology K01358
KEGG pathways map04112, map04212
Gene Ontology (15) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0016020, GO:0030312, GO:0040007, GO:0044424 +3 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CLP_proteasePF00574.29 1.8e-7430–206 Clp protease

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: clpP1 (ATP-dependent CLP protease proteolytic subunit 1), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2461c clpP1 ATP-dependent CLP protease proteolytic subunit 1 999 1000 ctx neighborhood:882 coexpression:794 experimental:999 database:540 textmining:595
Rv2457c clpX ATP-dependent CLP protease ATP-binding subunit ClpX 996 986 ctx cooccurence:699 coexpression:655 experimental:829 textmining:745
Rv3596c clpC1 ATP-dependent protease ATP-binding subunit ClpC 996 907 coexpression:478 experimental:754 textmining:963
Rv2462c tig trigger factor 894 847 ctx neighborhood:765
Rv0384c clpB chaperone protein ClpB 916 809 coexpression:470 experimental:529 textmining:583
Rv3716c hyp hypothetical protein 809 777 coexpression:770
Rv3195 hyp hypothetical protein 807 776 coexpression:776
Rv3418c groES chaperonin GroES 870 761 ctx cooccurence:434 experimental:420 textmining:481
Rv0429c def polypeptide deformylase 765 750 ctx cooccurence:531 coexpression:460
Rv2667 clpC2 ATP-dependent protease ATP-binding subunit ClpC 816 741 coexpression:462 experimental:529
Rv2374c hrcA heat-inducible transcription repressor HrcA 757 682 coexpression:682
Rv0440 groEL2 molecular chaperone GroEL 740 633 coexpression:425
Rv3417c groEL1 chaperonin GroEL 739 631 coexpression:423
Rv0640 rplK 50S ribosomal protein L11 780 623 ctx cooccurence:558 textmining:440
Rv0351 grpE stress response protein GrpE 746 592 coexpression:472 textmining:405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP-dependent CLP protease proteolytic subunit 2
  • MTBC0 PGAP product: ATP-dependent CLP protease proteolytic subunit ClpP2
  • Pfam (hmmscan --cut_ga): CLP_protease PF00574.29 (E=2e-74)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216976.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CLP_protease (PF00574.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0740
  • Curated reference: UniProt P9WPC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 101 functional partner(s); context anchor clpP1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002619|Rv2460c|clpP2
MNSQNSQIQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLSAQTA