clpP2 Family assigned · medium auto-curated

H37Rv Rv2460c · MTBC0 mtbc0_002619 · 214 aa · 2786779–2787423 MTBC0 (-) · RefSeq NP_216976.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP-dependent CLP protease proteolytic subunit 2
MTBC0 PGAP re-annotationATP-dependent CLP protease proteolytic subunit ClpP2
Revised (this work)ATP-dependent CLP protease proteolytic subunit ClpP2. Pfam: CLP_protease (PF00574.29).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 31 publications

31 TB publications mention this gene. 31 publication(s) discuss this gene (28 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (3), M. abscessus (1)).

Most recent 5 of 31.
PublicationDate
Activation mechanism and structural assembly of the Mycobacterium tuberculosis ClpP1P2 protease and its associated ATPases. doi:10.1016/j.celrep.2026.117400 2026
Elucidating the structural basis of ClpP activation and dynamics in Mycobacterium tuberculosis. doi:10.1080/07391102.2025.2609691 2026
Molecular Characterization of the ClpC AAA+ ATPase in the Biology of Chlamydia trachomatis. doi:10.1128/mbio.00075-23 2023
Identification of the inhibitory mechanism of ecumicin and rufomycin 4-7 on the proteolytic activity of Mycobacterium tuberculosis ClpC1/ClpP1/ClpP2 complex. doi:10.1016/j.tube.2022.102298 2023
Total Synthesis and Biological Evaluation of Modified Ilamycin Derivatives. doi:10.3390/md20100632 2022

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourclpP (Rv2461c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -10.58 (95% CI -11.50 to -9.59). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionCLP cleaves peptides in various proteins in a process that requires ATP hydrolysis. CLP may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.
Mycobrowser EC 3.4.21.92 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2487c · 99.5% identity
M. leprae ML1479c · 97.2% identity
M. marinum MMAR_3807 · 97.1% identity
M. smegmatis MSMEG_4672 · 93.4% identity
M. orygis RJtmp_002543 · 99.5% identity
M. abscessus MAB_1582 · 90.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WPC3 SwissProt · reviewed · Evidence at protein level
UniProt nameATP-dependent Clp protease proteolytic subunit 2
EC (curated) EC 3.4.21.92
Curated functionCleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Degrades anti-sigma-D factor RsdA when present in a complex with ClpP1 and ClpX. Degrades anti-sigma-E factor RseA in the presence of ClpC1. Does not seem to act on anti-sigma-L factor RslA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameclpP
eggNOG descriptionCleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins
Orthologous groupCOG0740
EC number EC 3.4.21.92
KEGG orthology K01358
KEGG pathways map04112, map04212
Gene Ontology (15) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0016020, GO:0030312, GO:0040007, GO:0044424 +3 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 96.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 70.4%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 10 in the ORF — 10 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance1470.0 ppm · rank 143/3519 (96.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length214 aa
Molecular weight23.5 kDa
Theoretical pI4.99
GRAVY-0.149 (hydrophilic)
Aliphatic index94.9
Aromaticity0.061
Instability index31.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CLP_proteasePF00574.29 1.8e-7430–206 Clp protease

Experimental structures (Protein Data Bank) 18 solved

PDBMethodResolutionCoverage
9p53 Electron Microscopy 2.77 Å 100%
9p54 Electron Microscopy 2.8 Å 100%
5e0s X-ray diffraction 2.9 Å 100%
5dzk X-ray diffraction 3.07 Å 100%
8yd4 Electron Microscopy 3.69 Å 100%
6iw7 X-ray diffraction 2.69212103413 Å 94%
9if4 Electron Microscopy 3.09 Å 94%
6vgn Electron Microscopy 3.1 Å 94%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (18 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.2

PDB hitprobTM-scoreE-valueDescription
5e0s-assembly1_B 1.00 0.99 6.0e-40 sig 5e0s-assembly1_B crystal structure of the active form of the proteolytic complex clpP1 and clpP2
6vgk-assembly1_A 1.00 0.94 7.5e-33 sig 6vgk-assembly1_A ClpP1P2 complex from M. tuberculosis
5dkp-assembly2_k 1.00 0.98 2.3e-28 sig 5dkp-assembly2_k Crystal Structure of N. meningitidis ClpP in complex with agonist ADEP A54556.
6vfx-assembly1_I 1.00 0.97 8.8e-28 sig 6vfx-assembly1_I ClpXP from Neisseria meningitidis - Conformation B
5dkp-assembly2_b 1.00 0.98 4.0e-27 sig 5dkp-assembly2_b Crystal Structure of N. meningitidis ClpP in complex with agonist ADEP A54556.

Foldseek search of the AlphaFold DB model (mean pLDDT 92.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv2459 (+ strand, 150 bp gap)
Downstream (3' on genome)clpP1 (- strand, -4 bp gap)
Predicted operon clpP2 · clpP1

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) mmpR5 (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: clpP1 (ATP-dependent CLP protease proteolytic subunit 1), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2461c clpP1 exp ATP-dependent CLP protease proteolytic subunit 1 999 1000 ctx neighborhood:882 coexpression:794 experimental:999 database:540 textmining:595
Rv2457c clpX exp ATP-dependent CLP protease ATP-binding subunit ClpX 996 986 ctx cooccurence:699 coexpression:655 experimental:829 textmining:745
Rv3596c clpC1 exp ATP-dependent protease ATP-binding subunit ClpC 996 907 coexpression:478 experimental:754 textmining:963
Rv2462c tig trigger factor 894 847 ctx neighborhood:765
Rv0384c clpB exp chaperone protein ClpB 916 809 coexpression:470 experimental:529 textmining:583
Rv3716c hyp hypothetical protein 809 777 coexpression:770
Rv3195 hyp hypothetical protein 807 776 coexpression:776
Rv3418c groES exp chaperonin GroES 870 761 ctx cooccurence:434 experimental:420 textmining:481
Rv0429c def polypeptide deformylase 765 750 ctx cooccurence:531 coexpression:460
Rv2667 clpC2 exp ATP-dependent protease ATP-binding subunit ClpC 816 741 coexpression:462 experimental:529
Rv2374c hrcA heat-inducible transcription repressor HrcA 757 682 coexpression:682
Rv0440 groEL2 molecular chaperone GroEL 740 633 coexpression:425
Rv3417c groEL1 chaperonin GroEL 739 631 coexpression:423
Rv0640 rplK 50S ribosomal protein L11 780 623 ctx cooccurence:558 textmining:440
Rv0351 grpE stress response protein GrpE 746 592 coexpression:472 textmining:405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP-dependent CLP protease proteolytic subunit 2
  • MTBC0 PGAP product: ATP-dependent CLP protease proteolytic subunit ClpP2
  • Pfam (hmmscan --cut_ga): CLP_protease PF00574.29 (E=2e-74)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216976.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CLP_protease (PF00574.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0740
  • Curated reference: UniProt P9WPC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 101 functional partner(s); context anchor clpP1
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002619|Rv2460c|clpP2
MNSQNSQIQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLSAQTA