frr Resolved · high auto-curated
H37Rv Rv2882c · MTBC0 mtbc0_003064 ·
185 aa · 3212366–3212923 (-) ·
RefSeq NP_217398.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ribosome recycling factor |
|---|---|
| MTBC0 PGAP re-annotation | ribosome recycling factor |
| Revised (this work) | Ribosome recycling factor. Pfam: RRF (PF01765.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGY1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ribosome-recycling factor |
| Curated function | Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | frr |
| eggNOG description | Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another |
| Orthologous group | COG0233 |
| KEGG orthology |
K02838
|
| Gene Ontology (58) |
GO:0002181, GO:0002184, GO:0003674, GO:0003676, GO:0003723, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005886 +46 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.626 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RRF | PF01765.25 | 5.7e-65 | 21–183 | Ribosome recycling factor |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rplM (50S ribosomal protein L13), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2890c rpsB |
30S ribosomal protein S2 | 996 | 990 | coexpression:782 experimental:928 textmining:617 |
Rv3443c rplM |
50S ribosomal protein L13 | 994 | 989 ctx | cooccurence:507 coexpression:678 experimental:928 textmining:581 |
Rv1643 rplT |
50S ribosomal protein L20 | 993 | 986 ctx | cooccurence:623 coexpression:505 experimental:928 textmining:560 |
Rv3456c rplQ |
50S ribosomal protein L17 | 986 | 985 | coexpression:690 experimental:928 |
Rv2785c rpsO |
30S ribosomal protein S15 | 988 | 984 ctx | cooccurence:651 experimental:928 |
Rv0708 rplP |
50S ribosomal protein L16 | 992 | 981 ctx | cooccurence:499 coexpression:525 experimental:928 textmining:591 |
Rv0700 rpsJ |
30S ribosomal protein S10 | 991 | 980 | coexpression:611 experimental:928 textmining:592 |
Rv0706 rplV |
50S ribosomal protein L22 | 982 | 980 ctx | cooccurence:563 coexpression:424 experimental:928 |
Rv0723 rplO |
50S ribosomal protein L15 | 980 | 980 | coexpression:662 experimental:928 |
Rv0683 rpsG |
30S ribosomal protein S7 | 981 | 979 | coexpression:660 experimental:928 |
Rv3458c rpsD |
30S ribosomal protein S4 | 981 | 979 | coexpression:713 experimental:911 |
Rv0701 rplC |
50S ribosomal protein L3 | 990 | 978 | coexpression:652 experimental:928 textmining:566 |
Rv0640 rplK |
50S ribosomal protein L11 | 988 | 978 | coexpression:636 experimental:927 textmining:513 |
Rv0682 rpsL |
30S ribosomal protein S12 | 990 | 975 | coexpression:661 experimental:928 textmining:623 |
Rv0715 rplX |
50S ribosomal protein L24 | 982 | 974 ctx | cooccurence:547 experimental:928 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ribosome recycling factor
- MTBC0 PGAP product: ribosome recycling factor
- Pfam (hmmscan --cut_ga): RRF PF01765.25 (E=6e-65)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217398.1)
- Domains: Pfam-A via hmmscan --cut_ga — RRF (PF01765.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0233 - Curated reference: UniProt P9WGY1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
182 functional partner(s); context anchor
rplM - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003064|Rv2882c|frr MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV