frr Resolved · high auto-curated

H37Rv Rv2882c · MTBC0 mtbc0_003064 · 185 aa · 3212366–3212923 (-) · RefSeq NP_217398.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribosome recycling factor
MTBC0 PGAP re-annotationribosome recycling factor
Revised (this work)Ribosome recycling factor. Pfam: RRF (PF01765.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGY1 SwissProt · reviewed · Evidence at protein level
UniProt nameRibosome-recycling factor
Curated functionResponsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namefrr
eggNOG descriptionResponsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another
Orthologous groupCOG0233
KEGG orthology K02838
Gene Ontology (58) GO:0002181, GO:0002184, GO:0003674, GO:0003676, GO:0003723, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005886 +46 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.626 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RRFPF01765.25 5.7e-6521–183 Ribosome recycling factor

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplM (50S ribosomal protein L13), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2890c rpsB 30S ribosomal protein S2 996 990 coexpression:782 experimental:928 textmining:617
Rv3443c rplM 50S ribosomal protein L13 994 989 ctx cooccurence:507 coexpression:678 experimental:928 textmining:581
Rv1643 rplT 50S ribosomal protein L20 993 986 ctx cooccurence:623 coexpression:505 experimental:928 textmining:560
Rv3456c rplQ 50S ribosomal protein L17 986 985 coexpression:690 experimental:928
Rv2785c rpsO 30S ribosomal protein S15 988 984 ctx cooccurence:651 experimental:928
Rv0708 rplP 50S ribosomal protein L16 992 981 ctx cooccurence:499 coexpression:525 experimental:928 textmining:591
Rv0700 rpsJ 30S ribosomal protein S10 991 980 coexpression:611 experimental:928 textmining:592
Rv0706 rplV 50S ribosomal protein L22 982 980 ctx cooccurence:563 coexpression:424 experimental:928
Rv0723 rplO 50S ribosomal protein L15 980 980 coexpression:662 experimental:928
Rv0683 rpsG 30S ribosomal protein S7 981 979 coexpression:660 experimental:928
Rv3458c rpsD 30S ribosomal protein S4 981 979 coexpression:713 experimental:911
Rv0701 rplC 50S ribosomal protein L3 990 978 coexpression:652 experimental:928 textmining:566
Rv0640 rplK 50S ribosomal protein L11 988 978 coexpression:636 experimental:927 textmining:513
Rv0682 rpsL 30S ribosomal protein S12 990 975 coexpression:661 experimental:928 textmining:623
Rv0715 rplX 50S ribosomal protein L24 982 974 ctx cooccurence:547 experimental:928

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribosome recycling factor
  • MTBC0 PGAP product: ribosome recycling factor
  • Pfam (hmmscan --cut_ga): RRF PF01765.25 (E=6e-65)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217398.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RRF (PF01765.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0233
  • Curated reference: UniProt P9WGY1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 182 functional partner(s); context anchor rplM
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003064|Rv2882c|frr
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV