mpt70 Family assigned · medium auto-curated
H37Rv Rv2875 · MTBC0 mtbc0_003058 ·
193 aa · 3207696–3208277 (+) ·
RefSeq NP_217391.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | major secreted immunogenic protein Mpt70 |
|---|---|
| MTBC0 PGAP re-annotation | fasciclin domain-containing protein |
| Revised (this work) | Fasciclin domain-containing protein. Pfam: Fasciclin (PF02469.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNF5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Immunogenic protein MPT70 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | mpt |
| eggNOG description | Fasciclin |
| Orthologous group | COG2335 |
| Gene Ontology (10) |
GO:0005575, GO:0005576, GO:0005615, GO:0005623, GO:0030288, GO:0030313, GO:0031975, GO:0042597, GO:0044421, GO:0044464
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.365 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fasciclin | PF02469.28 | 3.4e-29 | 70–191 | Fasciclin domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dipZ (integral membrane C-type cytochrome biogenesis protein DipZ), high confidence from genomic context alone (score 853 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2874 dipZ |
integral membrane C-type cytochrome biogenesis protein DipZ | 949 | 853 ctx | neighborhood:775 textmining:668 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 841 | 831 | experimental:829 |
Rv2876 |
transmembrane protein | 635 | 635 ctx | neighborhood:635 |
Rv0448c hyp |
hypothetical protein | 567 | 567 | coexpression:514 |
Rv0445c sigK |
ECF RNA polymerase sigma factor SigK | 914 | 490 ctx | cooccurence:413 textmining:840 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 479 | 448 | experimental:446 |
Rv3145 nuoA |
NADH-quinone oxidoreductase subunit A | 447 | 448 | experimental:446 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 447 | 448 | experimental:446 |
Rv3158 nuoN |
NADH-quinone oxidoreductase subunit N | 467 | 447 | experimental:446 |
Rv3152 nuoH |
NADH-quinone oxidoreductase subunit H | 447 | 447 | experimental:446 |
Rv3154 nuoJ |
NADH-quinone oxidoreductase subunit J | 446 | 447 | experimental:446 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 446 | 447 | experimental:446 |
Rv3155 nuoK |
NADH-quinone oxidoreductase subunit K | 446 | 446 | experimental:446 |
Rv3156 nuoL |
NADH-quinone oxidoreductase subunit L | 462 | 429 | experimental:420 |
Rv2873 mpt83 |
cell surface lipoprotein | 444 | 429 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: major secreted immunogenic protein Mpt70
- MTBC0 PGAP product: fasciclin domain-containing protein
- Pfam (hmmscan --cut_ga): Fasciclin PF02469.28 (E=3e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217391.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fasciclin (PF02469.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2335 - Curated reference: UniProt P9WNF5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
33 functional partner(s); context anchor
dipZ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003058|Rv2875|mpt70 MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPVAVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFAPTNAAFSKLPASTIDELKTNSSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA