mpt70 Family assigned · medium auto-curated

H37Rv Rv2875 · MTBC0 mtbc0_003058 · 193 aa · 3207696–3208277 (+) · RefSeq NP_217391.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)major secreted immunogenic protein Mpt70
MTBC0 PGAP re-annotationfasciclin domain-containing protein
Revised (this work)Fasciclin domain-containing protein. Pfam: Fasciclin (PF02469.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNF5 SwissProt · reviewed · Evidence at protein level
UniProt nameImmunogenic protein MPT70

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namempt
eggNOG descriptionFasciclin
Orthologous groupCOG2335
Gene Ontology (10) GO:0005575, GO:0005576, GO:0005615, GO:0005623, GO:0030288, GO:0030313, GO:0031975, GO:0042597, GO:0044421, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.365 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FasciclinPF02469.28 3.4e-2970–191 Fasciclin domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dipZ (integral membrane C-type cytochrome biogenesis protein DipZ), high confidence from genomic context alone (score 853 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 949 853 ctx neighborhood:775 textmining:668
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 841 831 experimental:829
Rv2876 transmembrane protein 635 635 ctx neighborhood:635
Rv0448c hyp hypothetical protein 567 567 coexpression:514
Rv0445c sigK ECF RNA polymerase sigma factor SigK 914 490 ctx cooccurence:413 textmining:840
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 479 448 experimental:446
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 447 448 experimental:446
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 447 448 experimental:446
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 467 447 experimental:446
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 447 447 experimental:446
Rv3154 nuoJ NADH-quinone oxidoreductase subunit J 446 447 experimental:446
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 446 447 experimental:446
Rv3155 nuoK NADH-quinone oxidoreductase subunit K 446 446 experimental:446
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 462 429 experimental:420
Rv2873 mpt83 cell surface lipoprotein 444 429

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: major secreted immunogenic protein Mpt70
  • MTBC0 PGAP product: fasciclin domain-containing protein
  • Pfam (hmmscan --cut_ga): Fasciclin PF02469.28 (E=3e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217391.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fasciclin (PF02469.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2335
  • Curated reference: UniProt P9WNF5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor dipZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003058|Rv2875|mpt70
MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPVAVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFAPTNAAFSKLPASTIDELKTNSSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA