pyrH Resolved · high auto-curated

H37Rv Rv2883c · MTBC0 mtbc0_003065 · 261 aa · 3213201–3213986 (-) · RefSeq NP_217399.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)uridylate kinase
MTBC0 PGAP re-annotationUMP kinase
Revised (this work)UMP kinase. Pfam: AA_kinase (PF00696.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHK5 SwissProt · reviewed · Evidence at protein level
UniProt nameUridylate kinase
EC (curated) EC 2.7.4.22
Curated functionCatalyzes the reversible phosphorylation of UMP to UDP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepyrH
eggNOG descriptionCatalyzes the reversible phosphorylation of UMP to UDP
Orthologous groupCOG0528
EC number EC 2.7.4.22
KEGG orthology K09903
KEGG pathways map00240, map01100
Gene Ontology (91) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006139, GO:0006213, GO:0006220, GO:0006221, GO:0006225 +79 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.709 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AA_kinasePF00696.34 1.2e-3332–239 Amino acid kinase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: frr (ribosome recycling factor), high confidence from genomic context alone (score 968 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2882c frr ribosome recycling factor 988 968 ctx neighborhood:744 coexpression:862 textmining:652
Rv3309c upp uracil phosphoribosyltransferase 962 951 coexpression:453 database:900
Rv1307 atpH ATP synthase subunit b/delta 950 948 coexpression:940
Rv2445c ndkA nucleoside diphosphate kinase 938 919 database:900
Rv1379 pyrR bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 935 916 database:900
Rv2889c tsf elongation factor EF-Ts 930 910 coexpression:855
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 945 909 database:900 textmining:431
Rv2890c rpsB 30S ribosomal protein S2 902 872 coexpression:841
Rv2881c cdsA phosphatidate cytidylyltransferase 901 870 ctx neighborhood:728 cooccurence:442
Rv0641 rplA 50S ribosomal protein L1 827 801 coexpression:706
Rv1017c prsA ribose-phosphate pyrophosphokinase 808 778 ctx cooccurence:607 coexpression:456
Rv0700 rpsJ 30S ribosomal protein S10 887 741 coexpression:703 textmining:583
Rv2462c tig trigger factor 729 730 coexpression:721
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 867 721 coexpression:674 textmining:543
Rv2906c trmD tRNA (guanine-N1)-methyltransferase 760 713 coexpression:649

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: uridylate kinase
  • MTBC0 PGAP product: UMP kinase
  • Pfam (hmmscan --cut_ga): AA_kinase PF00696.34 (E=1e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217399.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AA_kinase (PF00696.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0528
  • Curated reference: UniProt P9WHK5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 166 functional partner(s); context anchor frr
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003065|Rv2883c|pyrH
MTEPDVAGAPASKPEPASTGAASAAQLSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQIADVVRGGVQIAVVIGGGNFFRGAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEDPRVNPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAVRGEKIGTLVTT