dapB Resolved · high auto-curated

H37Rv Rv2773c · MTBC0 mtbc0_002952 · 245 aa · 3104019–3104756 (-) · RefSeq NP_217289.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)4-hydroxy-tetrahydrodipicolinate reductase
MTBC0 PGAP re-annotation4-hydroxy-tetrahydrodipicolinate reductase
Revised (this work)4-hydroxy-tetrahydrodipicolinate reductase. Pfam: DapB_N (PF01113.27), DapB_C (PF05173.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP23 SwissProt · reviewed · Evidence at protein level
UniProt name4-hydroxy-tetrahydrodipicolinate reductase
EC (curated) EC 1.17.1.8
Curated functionCatalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate (Probable). Can use both NADH and NADPH as a reductant, with NADH being 6-fold as effective as NADPH.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namedapB
eggNOG descriptionCatalyzes the conversion of 4-hydroxy- tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate
Orthologous groupCOG0289
EC number EC 1.17.1.8
KEGG orthology K00215
KEGG pathways map00261, map00300, map01100, map01110, map01120, map01130, map01230
KEGG modules M00016, M00525, M00526, M00527
Gene Ontology (66) GO:0000166, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082 +54 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.095 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DapB_NPF01113.27 3.8e-211–105 Dihydrodipicolinate reductase, N-terminus
DapB_CPF05173.20 8.0e-33108–240 Dihydrodipicolinate reductase, C-terminus

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dapA (4-hydroxy-tetrahydrodipicolinate synthase), high confidence from genomic context alone (score 990 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2753c dapA 4-hydroxy-tetrahydrodipicolinate synthase 997 990 ctx cooccurence:772 coexpression:479 database:900 textmining:778
Rv1201c dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 987 951 coexpression:416 database:900 textmining:767
Rv2772c transmembrane protein 894 878 ctx neighborhood:876
Rv1293 lysA diaminopimelate decarboxylase 979 825 ctx cooccurence:755 textmining:890
Rv2771c hyp hypothetical protein 792 785 ctx neighborhood:779
Rv3907c pcnA poly(A) polymerase PcnA 779 779 coexpression:761
Rv2774c hyp hypothetical protein 776 777 ctx neighborhood:776
Rv3708c asd aspartate-semialdehyde dehydrogenase 937 744 ctx cooccurence:466 coexpression:502 textmining:767
Rv2726c dapF diaminopimelate epimerase 969 731 ctx cooccurence:708 textmining:890
Rv3709c ask aspartokinase 918 683 ctx cooccurence:598 textmining:754
Rv1294 thrA homoserine dehydrogenase 689 590 ctx cooccurence:412
Rv1296 thrB homoserine kinase 738 572 coexpression:440 textmining:414
Rv2775 GCN5-like N-acetyltransferase 541 537 ctx neighborhood:535
Rv1178 dapC aminotransferase 801 500 ctx cooccurence:479 textmining:619
Rv2555c alaS alanine--tRNA ligase 436 436 coexpression:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 4-hydroxy-tetrahydrodipicolinate reductase
  • MTBC0 PGAP product: 4-hydroxy-tetrahydrodipicolinate reductase
  • Pfam (hmmscan --cut_ga): DapB_N PF01113.27 (E=4e-21), DapB_C PF05173.20 (E=8e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217289.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DapB_N (PF01113.27), DapB_C (PF05173.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0289
  • Curated reference: UniProt P9WP23 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 54 functional partner(s); context anchor dapA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002952|Rv2773c|dapB
MRVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH