efp Resolved · high auto-curated

H37Rv Rv2534c · MTBC0 - · 187 aa · 2858727–2859290 (-) · RefSeq NP_217050.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)elongation factor P
MTBC0 PGAP re-annotation
Revised (this work)Elongation factor P. Pfam: EFP_N (PF08207.19), EFP (PF01132.28), Elong-fact-P_C (PF09285.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WNM3 SwissProt · reviewed · Evidence at protein level
UniProt nameElongation factor P
Curated functionInvolved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nameefp
eggNOG descriptionInvolved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase
Orthologous groupCOG0231
KEGG orthology K02356
Gene Ontology (42) GO:0003674, GO:0003676, GO:0003723, GO:0003746, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006412, GO:0006414, GO:0006518 +30 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.111 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EFP_NPF08207.19 3.6e-263–60 Elongation factor P (EF-P) KOW-like domain
EFPPF01132.28 6.2e-2465–123 Elongation factor P (EF-P) OB domain
Elong-fact-P_CPF09285.18 1.6e-25129–184 Elongation factor P, C-terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsQ (30S ribosomal protein S17), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0710 rpsQ 30S ribosomal protein S17 994 993 ctx cooccurence:435 coexpression:844 experimental:928
Rv0720 rplR 50S ribosomal protein L18 993 991 coexpression:819 experimental:928
Rv0706 rplV 50S ribosomal protein L22 992 991 coexpression:812 experimental:928
Rv3443c rplM 50S ribosomal protein L13 991 991 coexpression:847 experimental:928
Rv3458c rpsD 30S ribosomal protein S4 991 991 coexpression:845 experimental:928
Rv0700 rpsJ 30S ribosomal protein S10 993 990 coexpression:861 experimental:928
Rv0682 rpsL 30S ribosomal protein S12 992 990 coexpression:840 experimental:928
Rv0683 rpsG 30S ribosomal protein S7 991 990 coexpression:839 experimental:928
Rv0714 rplN 50S ribosomal protein L14 991 990 coexpression:845 experimental:928
Rv2890c rpsB 30S ribosomal protein S2 991 989 coexpression:822 experimental:928
Rv0707 rpsC 30S ribosomal protein S3 990 989 coexpression:847 experimental:928
Rv2785c rpsO 30S ribosomal protein S15 990 989 coexpression:810 experimental:928
Rv0701 rplC 50S ribosomal protein L3 989 988 coexpression:836 experimental:928
Rv0641 rplA 50S ribosomal protein L1 990 987 coexpression:767 experimental:928
Rv0705 rpsS 30S ribosomal protein S19 989 987 coexpression:824 experimental:928

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): elongation factor P
  • Pfam (hmmscan --cut_ga): EFP_N PF08207.19 (E=4e-26), EFP PF01132.28 (E=6e-24), Elong-fact-P_C PF09285.18 (E=2e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217050.1)
  • Domains: Pfam-A via hmmscan --cut_ga — EFP_N (PF08207.19), EFP (PF01132.28), Elong-fact-P_C (PF09285.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0231
  • Curated reference: UniProt P9WNM3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 225 functional partner(s); context anchor rpsQ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2534c|efp
MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVDTATVDRRDTTYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGLQGDRSSAGTKPATLQTGAQINVPLFINTGDKLKVDSRDGSYLGRVNA