aspS Resolved · high auto-curated

H37Rv Rv2572c · MTBC0 mtbc0_002739 · 596 aa · 2919557–2921347 (-) · RefSeq NP_217088.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)aspartate--tRNA ligase
MTBC0 PGAP re-annotationaspartate--tRNA ligase
Revised (this work)Aspartate--tRNA ligase. Pfam: tRNA_anti-codon (PF01336.32), tRNA-synt_2 (PF00152.26), GAD (PF02938.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFW3 SwissProt · reviewed · Evidence at protein level
UniProt nameAspartate--tRNA(Asp/Asn) ligase
EC (curated) EC 6.1.1.23
Curated functionAspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two steps: L-aspartate is first activated by ATP to form Asp-AMP and then transferred to the acceptor end of tRNA(Asp/Asn).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nameaspS
eggNOG descriptionAspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two steps L-aspartate is first activated by ATP to form Asp-AMP and then transferred to the acceptor end of tRNA(Asp Asn)
Orthologous groupCOG0173
EC number EC 6.1.1.12
KEGG orthology K01876
KEGG pathways map00970
KEGG modules M00359, M00360
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.401 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 10.19% of strains (14793) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA_anti-codonPF01336.32 9.9e-1721–106 OB-fold nucleic acid binding domain
tRNA-synt_2PF00152.26 3.8e-115122–562 tRNA synthetases class II (D, K and N)
GADPF02938.20 6.1e-12315–395 GAD domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gatB (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3009c gatB aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 993 989 ctx fusion:850 coexpression:644 experimental:790 textmining:478
Rv3012c gatC glutamyl-tRNA(GLN) amidotransferase subunit C 985 871 experimental:836 textmining:895
Rv2571c transmembrane protein 847 848 ctx neighborhood:811
Rv2580c hisS histidine--tRNA ligase 877 836 coexpression:808
Rv2555c alaS alanine--tRNA ligase 829 792 coexpression:684
Rv3396c guaA GMP synthase 847 754 coexpression:707 textmining:405
Rv2448c valS valine--tRNA ligase 810 752 coexpression:732
Rv2573 2-dehydropantoate 2-reductase 745 746 ctx neighborhood:745
Rv1536 ileS isoleucine--tRNA ligase 908 649 coexpression:648 textmining:751
Rv2363 amiA2 amidase 664 643 coexpression:405 experimental:405
Rv2845c proS proline--tRNA ligase 825 641 coexpression:612 textmining:533
Rv3011c gatA glutamyl-tRNA(GLN) amidotransferase subunit A 771 639 experimental:405
Rv2888c amiC amidase AmiC 656 634 experimental:405
Rv2239c hyp hypothetical protein 634 634 ctx cooccurence:632
Rv3375 amiD amidase 727 633 experimental:405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: aspartate--tRNA ligase
  • MTBC0 PGAP product: aspartate--tRNA ligase
  • Pfam (hmmscan --cut_ga): tRNA_anti-codon PF01336.32 (E=1e-16), tRNA-synt_2 PF00152.26 (E=4e-115), GAD PF02938.20 (E=6e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217088.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA_anti-codon (PF01336.32), tRNA-synt_2 (PF00152.26), GAD (PF02938.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0173
  • Curated reference: UniProt P9WFW3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 112 functional partner(s); context anchor gatB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002739|Rv2572c|aspS
MFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA