mazE1 Resolved · medium auto-curated
H37Rv Rv0456B · MTBC0 - ·
57 aa · 547344–547517 (-) ·
RefSeq YP_007409102.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE1 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Antitoxin MazE1. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P0CL57
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable antitoxin MazE1 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. |
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF1 (toxin MazF1), high confidence from genomic context alone (score 781 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0456A mazF1 |
toxin MazF1 | 817 | 781 ctx | neighborhood:781 |
Rv0457c |
peptidase | 587 | 588 ctx | neighborhood:588 |
Rv0459 hyp |
hypothetical protein | 426 | 426 ctx | neighborhood:426 |
Rv0458 |
aldehyde dehydrogenase | 426 | 426 ctx | neighborhood:426 |
Rv0456c echA2 |
enoyl-CoA hydratase EchA2 | 417 | 417 ctx | neighborhood:417 |
Rv2801c mazF9 |
mRNA interferase MazF9 | 440 | 45 | textmining:438 |
Rv0660c mazE2 |
antitoxin MazE2 | 870 | 41 | textmining:870 |
Rv2274A mazE8 |
antitoxin MazE8 | 803 | 41 | textmining:803 |
Rv1991A mazE6 |
antitoxin MazE6 | 803 | 41 | textmining:803 |
Rv1103c mazE3 |
antitoxin MazE3 | 658 | 41 | textmining:658 |
Rv2595 vapB40 |
antitoxin VapB40 | 653 | 41 | textmining:653 |
Rv2801A mazE9 |
antitoxin MazE9 | 651 | 41 | textmining:651 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 642 | 41 | textmining:642 |
Rv0599c vapB27 |
antitoxin VapB27 | 625 | 41 | textmining:625 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE1
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007409102.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P0CL57 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
mazF1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0456B|mazE1 MTTYYYVLLSVTTWVGLRHEAKRELVYRGRRSIGRMPREWACRRSRRFAANGVDAAR