mazE1 Resolved · medium auto-curated

H37Rv Rv0456B · MTBC0 - · 57 aa · 547344–547517 (-) · RefSeq YP_007409102.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE1
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin MazE1.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P0CL57 SwissProt · reviewed · Inferred from homology
UniProt nameProbable antitoxin MazE1
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF1 (toxin MazF1), high confidence from genomic context alone (score 781 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0456A mazF1 toxin MazF1 817 781 ctx neighborhood:781
Rv0457c peptidase 587 588 ctx neighborhood:588
Rv0459 hyp hypothetical protein 426 426 ctx neighborhood:426
Rv0458 aldehyde dehydrogenase 426 426 ctx neighborhood:426
Rv0456c echA2 enoyl-CoA hydratase EchA2 417 417 ctx neighborhood:417
Rv2801c mazF9 mRNA interferase MazF9 440 45 textmining:438
Rv0660c mazE2 antitoxin MazE2 870 41 textmining:870
Rv2274A mazE8 antitoxin MazE8 803 41 textmining:803
Rv1991A mazE6 antitoxin MazE6 803 41 textmining:803
Rv1103c mazE3 antitoxin MazE3 658 41 textmining:658
Rv2595 vapB40 antitoxin VapB40 653 41 textmining:653
Rv2801A mazE9 antitoxin MazE9 651 41 textmining:651
Rv1991c mazF6 mRNA interferase MazF6 642 41 textmining:642
Rv0599c vapB27 antitoxin VapB27 625 41 textmining:625

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE1
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007409102.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P0CL57 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor mazF1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0456B|mazE1
MTTYYYVLLSVTTWVGLRHEAKRELVYRGRRSIGRMPREWACRRSRRFAANGVDAAR