mazE6 Resolved · medium auto-curated
H37Rv Rv1991A · MTBC0 - ·
82 aa · 2234643–2234891 (-) ·
RefSeq YP_007410673.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE6 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Antitoxin MazE6. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WJ87
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin MazE6 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and in M.smegmatis counteracts the ribonuclease activity of cognate toxin MazF6. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Transcriptional regulator |
| Orthologous group | COG0864 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF6 (mRNA interferase MazF6), high confidence from genomic context alone (score 950 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1991c mazF6 |
mRNA interferase MazF6 | 990 | 950 ctx | neighborhood:882 experimental:434 textmining:820 |
Rv2801c mazF9 |
mRNA interferase MazF9 | 860 | 616 | experimental:434 textmining:652 |
Rv0456A mazF1 |
toxin MazF1 | 662 | 616 | experimental:434 |
Rv2063A mazF7 |
mRNA interferase MazF7 | 655 | 616 | experimental:434 |
Rv1102c mazF3 |
mRNA interferase MazF3 | 782 | 607 | experimental:434 textmining:468 |
Rv0659c mazF2 |
toxin MazF2 | 669 | 607 | experimental:434 |
Rv1942c mazF5 |
toxin MazF5 | 656 | 607 | experimental:434 |
Rv1495 mazF4 |
mRNA interferase MazF4 | 638 | 607 | experimental:434 |
Rv3098A |
PemK-like protein | 630 | 607 | experimental:434 |
Rv2405 hyp |
hypothetical protein | 623 | 600 | experimental:430 |
Rv1990A |
Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g | 599 | 599 ctx | neighborhood:594 |
Rv1992c ctpG |
cation transporter ATPase G | 579 | 560 ctx | neighborhood:536 |
Rv1364c |
sigma factor regulatory protein | 559 | 539 ctx | neighborhood:534 |
Rv1993c hyp |
hypothetical protein | 536 | 536 ctx | neighborhood:536 |
Rv1994c cmtR |
HTH-type transcriptional regulator CmtR | 462 | 432 ctx | neighborhood:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE6
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007410673.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0864 - Curated reference: UniProt P9WJ87 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
mazF6 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1991A|mazE6 MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQIDRALESIHGTDEAEALAVANAYRVLETMDDEW