mazE6 Resolved · medium auto-curated

H37Rv Rv1991A · MTBC0 - · 82 aa · 2234643–2234891 (-) · RefSeq YP_007410673.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE6
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin MazE6.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJ87 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin MazE6
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and in M.smegmatis counteracts the ribonuclease activity of cognate toxin MazF6.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG0864

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF6 (mRNA interferase MazF6), high confidence from genomic context alone (score 950 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1991c mazF6 mRNA interferase MazF6 990 950 ctx neighborhood:882 experimental:434 textmining:820
Rv2801c mazF9 mRNA interferase MazF9 860 616 experimental:434 textmining:652
Rv0456A mazF1 toxin MazF1 662 616 experimental:434
Rv2063A mazF7 mRNA interferase MazF7 655 616 experimental:434
Rv1102c mazF3 mRNA interferase MazF3 782 607 experimental:434 textmining:468
Rv0659c mazF2 toxin MazF2 669 607 experimental:434
Rv1942c mazF5 toxin MazF5 656 607 experimental:434
Rv1495 mazF4 mRNA interferase MazF4 638 607 experimental:434
Rv3098A PemK-like protein 630 607 experimental:434
Rv2405 hyp hypothetical protein 623 600 experimental:430
Rv1990A Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g 599 599 ctx neighborhood:594
Rv1992c ctpG cation transporter ATPase G 579 560 ctx neighborhood:536
Rv1364c sigma factor regulatory protein 559 539 ctx neighborhood:534
Rv1993c hyp hypothetical protein 536 536 ctx neighborhood:536
Rv1994c cmtR HTH-type transcriptional regulator CmtR 462 432 ctx neighborhood:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE6
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007410673.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0864
  • Curated reference: UniProt P9WJ87 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor mazF6
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1991A|mazE6
MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQIDRALESIHGTDEAEALAVANAYRVLETMDDEW