Rv2851c Family assigned · medium auto-curated

H37Rv Rv2851c · MTBC0 mtbc0_003030 · 156 aa · 3180717–3181187 (-) · RefSeq NP_217367.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GCN5-like N-acetyltransferase
MTBC0 PGAP re-annotationGNAT family N-acetyltransferase
Revised (this work)GNAT family N-acetyltransferase. Pfam: Acetyltransf_10 (PF13673.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFQ5 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0039 protein Rv2851c

UniProt still lists this protein as UPF0039 protein Rv2851c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameelaA
eggNOG descriptionAcetyltransferase (GNAT) domain
Orthologous groupCOG2153
KEGG orthology K02348

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_10PF13673.14 8.9e-1444–145 Acetyltransferase (GNAT) domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2850c (magnesium chelatase), high confidence from genomic context alone (score 889 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2850c magnesium chelatase 984 889 ctx neighborhood:881 textmining:870
Rv2848c cobB cobyrinic acid A,C-diamide synthase 981 860 ctx neighborhood:857 textmining:870
Rv2849c cobO cob(I)alamin adenosyltransferase 972 859 ctx neighborhood:857 textmining:810
Rv2852c mqo malate:quinone oxidoreductase 841 814 ctx neighborhood:804
Rv3610c ftsH zinc metalloprotease FtsH 785 785 coexpression:785
Rv0425c ctpH metal cation transporting ATPase H 756 756 coexpression:756
Rv2553c mltG membrane protein 731 732 coexpression:731
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 713 713 ctx neighborhood:709
Rv2846c efpA MFS-type transporter EfpA 699 700 ctx neighborhood:698
Rv2854 hyp hypothetical protein 689 690 ctx neighborhood:688
Rv2855 mtr mycothione reductase 685 685 ctx neighborhood:683
Rv2845c proS proline--tRNA ligase 475 475 ctx neighborhood:459
Rv0519c membrane protein 465 466 coexpression:422
Rv2853 PE_PGRS48 PE-PGRS family protein PE_PGRS48 410 410 ctx neighborhood:410
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 404 405 coexpression:405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GCN5-like N-acetyltransferase
  • MTBC0 PGAP product: GNAT family N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_10 PF13673.14 (E=9e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217367.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_10 (PF13673.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2153
  • Curated reference: UniProt P9WFQ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv2850c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003030|Rv2851c|
MTEALRRVWAKDLDARALYELLKLRVEVFVVEQACPYPELDGRDLLAETRHFWLETPDGEVTCTLRLMEEHAGGEKVFRIGRLCTKRDARGQGHSNRLLCAALAEVGDYPCRIDAQAYLTAMYAQHGFVRDGDEFLDDGIPHVPMLRPGSGQVERP