Rv2851c Family assigned · medium auto-curated
H37Rv Rv2851c · MTBC0 mtbc0_003030 ·
156 aa · 3180717–3181187 (-) ·
RefSeq NP_217367.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | GNAT family N-acetyltransferase |
| Revised (this work) | GNAT family N-acetyltransferase. Pfam: Acetyltransf_10 (PF13673.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WFQ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | UPF0039 protein Rv2851c |
UniProt still lists this protein as UPF0039 protein Rv2851c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | elaA |
| eggNOG description | Acetyltransferase (GNAT) domain |
| Orthologous group | COG2153 |
| KEGG orthology |
K02348
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_10 | PF13673.14 | 8.9e-14 | 44–145 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2850c (magnesium chelatase), high confidence from genomic context alone (score 889 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2850c |
magnesium chelatase | 984 | 889 ctx | neighborhood:881 textmining:870 |
Rv2848c cobB |
cobyrinic acid A,C-diamide synthase | 981 | 860 ctx | neighborhood:857 textmining:870 |
Rv2849c cobO |
cob(I)alamin adenosyltransferase | 972 | 859 ctx | neighborhood:857 textmining:810 |
Rv2852c mqo |
malate:quinone oxidoreductase | 841 | 814 ctx | neighborhood:804 |
Rv3610c ftsH |
zinc metalloprotease FtsH | 785 | 785 | coexpression:785 |
Rv0425c ctpH |
metal cation transporting ATPase H | 756 | 756 | coexpression:756 |
Rv2553c mltG |
membrane protein | 731 | 732 | coexpression:731 |
Rv2847c cysG |
multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase | 713 | 713 ctx | neighborhood:709 |
Rv2846c efpA |
MFS-type transporter EfpA | 699 | 700 ctx | neighborhood:698 |
Rv2854 hyp |
hypothetical protein | 689 | 690 ctx | neighborhood:688 |
Rv2855 mtr |
mycothione reductase | 685 | 685 ctx | neighborhood:683 |
Rv2845c proS |
proline--tRNA ligase | 475 | 475 ctx | neighborhood:459 |
Rv0519c |
membrane protein | 465 | 466 | coexpression:422 |
Rv2853 PE_PGRS48 |
PE-PGRS family protein PE_PGRS48 | 410 | 410 ctx | neighborhood:410 |
Rv0668 rpoC |
DNA-directed RNA polymerase subunit beta' | 404 | 405 | coexpression:405 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: GNAT family N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_10 PF13673.14 (E=9e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217367.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_10 (PF13673.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2153 - Curated reference: UniProt P9WFQ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
Rv2850c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003030|Rv2851c| MTEALRRVWAKDLDARALYELLKLRVEVFVVEQACPYPELDGRDLLAETRHFWLETPDGEVTCTLRLMEEHAGGEKVFRIGRLCTKRDARGQGHSNRLLCAALAEVGDYPCRIDAQAYLTAMYAQHGFVRDGDEFLDDGIPHVPMLRPGSGQVERP