Rv2955c Resolved · high auto-curated
H37Rv Rv2955c · MTBC0 mtbc0_003137 ·
321 aa ·
3328755–3329720 MTBC0
(-) ·
RefSeq NP_217471.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | [2-O-methyl-alpha-L-fucopyranosyl-(1->3)-alpha-L-rhamnopyranosyl-(1->3)-2-O-methyl-alpha-L-rhamnopyranosyl] dimycocerosyl phenol-phthiocerol 4'''-O-methyltransferase |
| Revised (this work) | [2-O-methyl-alpha-L-fucopyranosyl-(1->3)-alpha-L-rhamnopyranosyl-(1->3)-2-O-methyl-alpha-L-rhamnopyranosyl] dimycocerosyl phenol-phthiocerol 4'''-O-methyltransferase. Pfam: Methyltransf_21 (PF05050.20). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
Found under: H37Rv (2).
2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Molecular epidemiology and whole genome sequencing analysis of clinical Mycobacterium bovis from Ghana. doi:10.1371/journal.pone.0209395 | 2019 |
| Functional characterisation of three o-methyltransferases involved in the biosynthesis of phenolglycolipids in Mycobacterium tuberculosis. doi:10.1371/journal.pone.0058954 | 2013 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 24% of residues (metapredict) · mean AlphaFold pLDDT 76.3 |
|---|---|
| Disordered regions | 1 IDR(s), longest 77 aa [0-77] |
carries a substantial disordered region (77/321 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 0.13 (95% CI -2.25 to 3.76). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2979c
· 99.4% identity |
|---|---|
| M. marinum |
MMAR_4517
· 33.7% identity |
| M. orygis |
RJtmp_003046
· 99.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P95137
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| eggNOG description | Methyltransferase FkbM domain |
| Orthologous group | COG2242 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.538 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 1.09% of strains (1588) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 21/53 (40%) · mean identity 39.6%
· 1/4 closest MTBAP relatives present in a subset of the genus (21/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 21 in the ORF — 0 in the essential state, 0 growth-defect, 21 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 96.3333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 95.4 ppm · rank 1325/3519 (62.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 321 aa |
|---|---|
| Molecular weight | 35.9 kDa |
| Theoretical pI | 9.25 |
| GRAVY | -0.156 (hydrophilic) |
| Aliphatic index | 94.0 |
| Aromaticity | 0.087 |
| Instability index | 41.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Methyltransf_21 | PF05050.20 | 2.5e-17 | 133–290 | Methyltransferase FkbM domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 76.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1f38-assembly1_A |
1.00 | 0.60 | 5.2e-06 sig | 1f38-assembly1_A X-RAY CRYSTALLOGRAPHIC STRUCTURE OF PRECORRIN 8W DECARBOXYLASE, THE PRODUCT OF GENE MT0146 IN THE METHANOBACTERIUM THERMOAUTOTROPHICUM GENOME |
8r4z-assembly2_B-2 |
1.00 | 0.44 | 3.6e-05 sig | 8r4z-assembly2_B-2 Crystal structure of alpha keto acid C-methyl-transferases MrsA native-form |
3egi-assembly1_A |
1.00 | 0.54 | 1.2e-04 sig | 3egi-assembly1_A Methyltransferase domain of human trimethylguanosine synthase TGS1 bound to m7GpppA (inactive form) |
3egi-assembly1_C |
1.00 | 0.55 | 1.9e-04 sig | 3egi-assembly1_C Methyltransferase domain of human trimethylguanosine synthase TGS1 bound to m7GpppA (inactive form) |
3gdh-assembly3_C |
1.00 | 0.52 | 9.0e-05 sig | 3gdh-assembly3_C Methyltransferase domain of human Trimethylguanosine Synthase 1 (TGS1) bound to m7GTP and adenosyl-homocysteine (active form) |
Foldseek search of the AlphaFold DB model (mean pLDDT 76.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2954c (- strand, 188 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2956 (+ strand, 122 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2957 (PGL/p-HBAD biosynthesis glycosyltransferase), medium confidence from genomic context alone (score 541 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2956 hyp exp |
hypothetical protein | 952 | 867 ctx | neighborhood:544 cooccurence:462 database:500 textmining:658 |
Rv2954c hyp exp |
hypothetical protein | 968 | 780 ctx | neighborhood:460 database:500 textmining:864 |
Rv2957 |
PGL/p-HBAD biosynthesis glycosyltransferase | 728 | 541 ctx | neighborhood:427 textmining:434 |
Rv3727 |
oxidoreductase | 505 | 505 ctx | cooccurence:505 |
Rv0341 iniB |
isoniazid inducible protein IniB | 471 | 472 | |
Rv2305 hyp |
hypothetical protein | 466 | 466 | |
Rv2949c |
chorismate pyruvate-lyase | 433 | 434 ctx | cooccurence:430 |
Rv0240 vapC24 |
ribonuclease VapC24 | 701 | 412 ctx | cooccurence:408 textmining:513 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 408 | 408 ctx | cooccurence:407 |
Rv0754 PE_PGRS11 |
PE-PGRS family protein PE_PGRS11 | 420 | 256 | |
Rv3377c |
type B diterpene cyclase | 553 | 237 | textmining:439 |
Rv2946c pks1 |
polyketide synthase | 418 | 231 | |
Rv2275 |
cyclo(L-tyrosyl-L-tyrosyl) synthase | 684 | 195 | textmining:624 |
Rv1359 |
transcriptional regulator | 472 | 195 | |
Rv3376 |
phosphatase | 590 | 192 | textmining:514 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: [2-O-methyl-alpha-L-fucopyranosyl-(1->3)-alpha-L-rhamnopyranosyl-(1->3)-2-O-methyl-alpha-L-rhamnopyranosyl] dimycocerosyl phenol-phthiocerol 4'''-O-methyltransferase
- Pfam (hmmscan --cut_ga): Methyltransf_21 PF05050.20 (E=2e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217471.1)
- Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_21 (PF05050.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2242 - Curated reference: UniProt P95137 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 76.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
Rv2957 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003137|Rv2955c| MQFQDVRLMRVVVCRRLGPAKGQRRWRPLDLGTTGCFENLGAQRPTYRMRAIRMLECAMPNRLVRSLQRWRPFGLPPHRWRLAPWYWRGLQVTLEPGSAIAWIVRLTGGFEETEIDIAAALYSALYPDRCILDVGANVGIHSLAWARLAPVVALEPAPGTHSRLEANVAANGLQDRIRTLRTAAGDAVGEVDFFVAADSAFSSLNDTGRIRIRERTRVPCTTLDALAAELPLPVGLLKIDVEGLERAVIAGAAELLRRDRPVLLVEIYGGAASNPDPERTIADIRAYGYEPFVYADDAGLQPYQRHRDDRYCYFFIPSRKG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2955c? Email the maintainer — the message is pre-filled with this gene's details.