Rv2275 Resolved · high auto-curated

H37Rv Rv2275 · MTBC0 - · 289 aa · 2546883–2547752 (+) · RefSeq NP_216791.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclo(L-tyrosyl-L-tyrosyl) synthase
MTBC0 PGAP re-annotation
Revised (this work)Cyclo(L-tyrosyl-L-tyrosyl) synthase. Pfam: CDPS (PF16715.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WPF9 SwissProt · reviewed · Evidence at protein level
UniProt nameCyclo(L-tyrosyl-L-tyrosyl) synthase
EC (curated) EC 2.3.2.21
Curated functionInvolved in the biosynthesis of mycocyclosin. It uses activated amino acids in the form of aminoacyl-tRNAs (aa-tRNAs) as substrates to catalyze the ATP-independent formation of cyclodipeptides which are intermediates in diketopiperazine (DKP) biosynthetic pathways. Catalyzes the formation of cyclo(L-Tyr-L-Tyr) (cYY) from L-tyrosyl-tRNA(Tyr). Can incorporate various nonpolar residues, such as L-phenylalanine, L-leucine, L-tyrosine and L-methionine, and to a much lesser extent L-alanine, into cyclodipeptides. Cyclodipeptides synthesized by Rv2275 always contain L-tyrosine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionCyclodipeptide synthase
Orthologous group2EW5R
EC number EC 2.3.2.20, EC 2.3.2.21
KEGG orthology K17484, K21382
Gene Ontology (8) GO:0003674, GO:0003824, GO:0016740, GO:0016746, GO:0016755, GO:0016874, GO:0016875, GO:0140096

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 17.46% of strains (25352) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CDPSPF16715.12 9.6e-9164–283 Cyclodipeptide synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp121 (cytochrome P450 Cyp121), high confidence from genomic context alone (score 991 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2276 cyp121 cytochrome P450 Cyp121 996 991 ctx neighborhood:881 coexpression:820 database:500 textmining:648
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 737 737 ctx cooccurence:737
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 731 731 ctx cooccurence:731
Rv0355c PPE8 PPE family protein PPE8 730 730 ctx cooccurence:730
Rv3350c PPE56 PPE family protein PPE56 728 729 ctx cooccurence:728
Rv3347c PPE55 PPE family protein PPE55 725 726 ctx cooccurence:725
Rv1004c membrane protein 721 721 ctx cooccurence:721
Rv1917c PPE34 PPE family protein PPE34 720 720 ctx cooccurence:719
Rv0304c PPE5 PPE family protein PPE5 709 710 ctx cooccurence:709
Rv2209 integral membrane protein 709 709 ctx cooccurence:708
Rv3343c PPE54 PPE family protein PPE54 700 700 ctx cooccurence:696
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 695 695 ctx cooccurence:695
Rv2819c csm5 CRISPR type III-associated RAMP protein Csm5 690 691 ctx cooccurence:690
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 689 689 ctx cooccurence:689
Rv2082 hyp hypothetical protein 684 685 ctx cooccurence:683

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): cyclo(L-tyrosyl-L-tyrosyl) synthase
  • Pfam (hmmscan --cut_ga): CDPS PF16715.12 (E=1e-90)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216791.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CDPS (PF16715.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EW5R
  • Curated reference: UniProt P9WPF9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 94 functional partner(s); context anchor cyp121
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2275|
MSYVAAEPGVLISPTDDLQSPRSAPAAHDENADGITGGTRDDSAPNSRFQLGRRIPEATAQEGFLVRPFTQQCQIIHTEGDHAVIGVSPGNSYFSRQRLRDLGLWGLTNFDRVDFVYTDVHVAESYEALGDSAIEARRKAVKNIRGVRAKITTTVNELDPAGARLCVRPMSEFQSNEAYRELHADLLTRLKDDEDLRAVCQDLVRRFLSTKVGPRQGATATQEQVCMDYICAEAPLFLDTPAILGVPSSLNCYHQSLPLAEMLYARGSGLRASRNQGHAIVTPDGSPAE