Rv3386 Resolved · medium auto-curated

H37Rv Rv3386 · MTBC0 - · 234 aa · 3800092–3800796 (+) · RefSeq NP_217903.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transposase
MTBC0 PGAP re-annotation
Revised (this work)Transposase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O50413 TrEMBL · unreviewed · Predicted
UniProt namePossible transposase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionTransposase domain (DUF772)
Orthologous groupCOG3039
KEGG orthology K07481

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.373 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF772PF05598.17 2.5e-1624–111 Transposase domain (DUF772)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3387 (transposase), high confidence from genomic context alone (score 986 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3387 transposase 985 986 ctx neighborhood:882 fusion:494 cooccurence:774
Rv1034c Probable transposase (fragment); Rv1034c, (MTCY10G2.15), len: 129 aa. Probable IS1560 transposase fragment, similar to part of Rv3387|E12023 868 869 ctx fusion:434 cooccurence:774
Rv2961 transposase 805 805 ctx cooccurence:774
Rv3385c vapB46 antitoxin VapB46 544 544 ctx neighborhood:542
Rv3384c vapC46 ribonuclease VapC46 524 524 ctx neighborhood:524
Rv0790c hyp hypothetical protein 518 518 ctx cooccurence:518
Rv0582 vapC26 ribonuclease VapC26 515 515 ctx cooccurence:515
Rv1495 mazF4 mRNA interferase MazF4 490 491 ctx cooccurence:488
Rv2549c vapC20 ribonuclease VapC20 465 465 ctx cooccurence:465
Rv3388 PE_PGRS52 PE-PGRS family protein PE_PGRS52 452 452 ctx neighborhood:452
Rv2086 hyp hypothetical protein 447 447 ctx cooccurence:444
Rv2735c hyp hypothetical protein 406 406 ctx cooccurence:403
Rv0071 maturase 404 405
Rv2014 Transposase; Rv2014, (MTCY39.03c), len: 196 aa. Transposase,similar to insertion elements; possibly made by frameshifting with respect to Rv 400 400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transposase
  • Pfam (hmmscan --cut_ga): DUF772 PF05598.17 (E=3e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217903.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF772 (PF05598.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3039
  • Curated reference: UniProt O50413 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv3387
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3386|
MFRTVGDQASLWESVLPEELRRLPEELARVDALLDDSAFFCPFVPFFDPRMGRPSIPMETYLRLMFLKFRYRLGYESLCREVTDSITWRRFCRIPLEGSVPHPTTLMKLTTRCGEDAVAGLNEALLAKAASEKLLRTNKVRADTTVVEGDVGYPTDTGLLAKAVGSMARTVARIKAADAGSAPLGGSSGPRDRLQAAVTRRAATRSGAGLRAPDHRGASRDRRAGADRGCRGGT