aroA Resolved · high auto-curated
H37Rv Rv3227 · MTBC0 mtbc0_003436 ·
450 aa ·
3625519–3626871 MTBC0
(+) ·
RefSeq NP_217744.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 3-phosphoshikimate 1-carboxyvinyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | 3-phosphoshikimate 1-carboxyvinyltransferase |
| Revised (this work) | 3-phosphoshikimate 1-carboxyvinyltransferase. Pfam: EPSP_synthase (PF00275.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 8 publications
8 TB publications mention this gene. 8 publication(s) discuss this gene (10 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| EPSP Synthase-Depleted Cells Are Aromatic Amino Acid Auxotrophs in Mycobacterium smegmatis. doi:10.1128/Spectrum.00009-21 | 2021 |
| An attenuated Salmonella-vectored vaccine elicits protective immunity against Mycobacterium tuberculosis. doi:10.1016/j.vaccine.2009.08.096 | 2009 |
| Novel bacterial delivery system with attenuated Salmonella typhimurium carrying plasmid encoding Mtb antigen 85A for mucosal immunization: establishment of proof of principle in TB mouse model. doi:10.1196/annals.1352.030 | 2005 |
| One-step purification of 5-enolpyruvylshikimate-3-phosphate synthase enzyme from Mycobacterium tuberculosis. doi:10.1016/s1046-5928(02)00708-8 | 2003 |
| The common aromatic amino acid biosynthesis pathway is essential in Mycobacterium tuberculosis. doi:10.1099/00221287-148-10-3069 | 2002 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | rsgA (Rv3228, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -9.01 (95% CI -10.47 to -7.53). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in the biosynthesis of chorismate within the biosynthesis of aromatic amino acids (the shikimate pathway). Acts in the sixth step of this pathway. [catalytic activity: phosphoenolpyruvate + 3-phosphoshikimate = orthophosphate + O(5)-(1-carboxyvinyl)-3-phosphoshikimate]. |
|---|---|
| Mycobrowser EC |
2.5.1.19
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3256
· 99.6% identity |
|---|---|
| M. leprae |
ML0792c
· 79.7% identity |
| M. marinum |
MMAR_1320
· 83.0% identity |
| M. smegmatis |
MSMEG_1890
· 68.3% identity |
| M. orygis |
RJtmp_003328
· 99.8% identity |
| M. abscessus |
MAB_3546
· 62.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WPY5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 3-phosphoshikimate 1-carboxyvinyltransferase |
| EC (curated) |
EC 2.5.1.19
|
| Curated function | Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | aroA |
| eggNOG description | Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3- phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate |
| Orthologous group | COG0128 |
| EC number |
EC 2.5.1.19
|
| KEGG orthology |
K00800
|
| KEGG pathways |
map00400, map01100, map01110, map01130, map01230
|
| KEGG modules |
M00022
|
| Gene Ontology (35) |
GO:0003674, GO:0003824, GO:0003866, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082, GO:0008150, GO:0008152 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.401 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 9 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.146
· 18 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.146) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 80.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 52.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 8 in the ORF — 7 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.125, mean read count 2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +6.38 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=631) from East Asian lineage (compared to H37Rv control) (strain background) | +5.96 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +5.37 | 0.014 | required |
| Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) | +5.36 | 0.0049 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +5.16 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +4.78 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 133.0 ppm · rank 1092/3519 (69.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 450 aa |
|---|---|
| Molecular weight | 46.4 kDa |
| Theoretical pI | 9.17 |
| GRAVY | 0.063 (hydrophobic) |
| Aliphatic index | 94.4 |
| Aromaticity | 0.04 |
| Instability index | 39.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
EPSP_synthase | PF00275.26 | 1.9e-119 | 8–417 | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
Experimental structures (Protein Data Bank) 7 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2o0b |
X-ray diffraction | 1.15 Å | 100% |
2o0d |
X-ray diffraction | 1.6 Å | 100% |
2bjb |
X-ray diffraction | 1.8 Å | 100% |
2o0e |
X-ray diffraction | 1.81 Å | 100% |
2o15 |
X-ray diffraction | 1.95 Å | 100% |
2o0x |
X-ray diffraction | 1.96 Å | 100% |
2o0z |
X-ray diffraction | 2.0 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (7 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2o15-assembly1_A |
1.00 | 0.99 | 4.3e-86 sig | 2o15-assembly1_A Mycobacterium tuberculosis epsp synthase after partial products withdrawal |
2bjb-assembly1_A |
1.00 | 0.83 | 1.8e-78 sig | 2bjb-assembly1_A Mycobacterium Tuberculosis Epsp Synthase In Unliganded State |
8umk-assembly2_B |
1.00 | 0.89 | 3.4e-40 sig | 8umk-assembly2_B EPSPS TIPS variant complexed with glyphosate and shikimate-3-phosphate |
8umm-assembly2_B |
1.00 | 0.87 | 1.6e-40 sig | 8umm-assembly2_B EPSPS TIPS K296R variant complexed with glyphosate and shikimate-3-phosphate |
8umm-assembly1_A |
1.00 | 0.88 | 2.0e-40 sig | 8umm-assembly1_A EPSPS TIPS K296R variant complexed with glyphosate and shikimate-3-phosphate |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv3226c (- strand, 54 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3228 (+ strand, -4 bp gap) |
| Predicted operon |
aroA · Rv3228
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
csoR (activates) · Rv1353c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: aroF (chorismate synthase), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2540c aroF exp |
chorismate synthase | 995 | 989 ctx | cooccurence:508 coexpression:770 database:900 textmining:561 |
Rv2552c aroE |
shikimate 5-dehydrogenase | 995 | 987 ctx | fusion:898 cooccurence:637 coexpression:646 textmining:657 |
Rv2538c aroB |
3-dehydroquinate synthase | 992 | 986 ctx | fusion:900 cooccurence:645 coexpression:580 textmining:510 |
Rv2539c aroK exp |
shikimate kinase | 988 | 977 ctx | cooccurence:562 coexpression:471 database:900 textmining:529 |
Rv1712 cmk |
cytidylate kinase | 923 | 913 ctx | fusion:896 |
Rv3228 rsgA hyp |
hypothetical protein | 948 | 904 ctx | neighborhood:882 textmining:485 |
Rv3226c hyp |
hypothetical protein | 886 | 788 ctx | neighborhood:787 textmining:485 |
Rv3754 tyrA |
prephenate dehydrogenase TyrA | 763 | 691 | coexpression:648 |
Rv3859c gltB |
glutamate synthase large subunit | 686 | 687 | coexpression:647 |
Rv0948c |
chorismate mutase | 716 | 678 | coexpression:660 |
Rv1885c |
chorismate mutase | 716 | 678 | coexpression:660 |
Rv0884c serC |
phosphoserine aminotransferase | 733 | 677 | coexpression:650 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 683 | 639 | coexpression:435 |
Rv1600 hisC1 |
histidinol-phosphate aminotransferase | 598 | 542 | coexpression:404 |
Rv3772 hisC2 |
histidinol-phosphate aminotransferase | 543 | 494 | coexpression:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 3-phosphoshikimate 1-carboxyvinyltransferase
- MTBC0 PGAP product: 3-phosphoshikimate 1-carboxyvinyltransferase
- Pfam (hmmscan --cut_ga): EPSP_synthase PF00275.26 (E=2e-119)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217744.1)
- Domains: Pfam-A via hmmscan --cut_ga — EPSP_synthase (PF00275.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0128 - Curated reference: UniProt P9WPY5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
32 functional partner(s); context anchor
aroF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003436|Rv3227|aroA MKTWPAPTAPTPVRATVTVPGSKSQTNRALVLAALAAAQGRGASTISGALRSRDTELMLDALQTLGLRVDGVGSELTVSGRIEPGPGARVDCGLAGTVLRFVPPLAALGSVPVTFDGDQQARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAAVVSGGTVRITGWPRVSVQPADHILAILRQLNAVVIHADSSLEVRGPTGYDGFDVDLRAVGELTPSVAALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCRETPDGLVITATPLRPGIWRAYADHRMAMAGAIIGLRVAGVEVDDIAATTKTLPEFPRLWAEMVGPGQGWGYPQPRSGQRARRATGQGSGG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for aroA? Email the maintainer — the message is pre-filled with this gene's details.