aroA Resolved · high auto-curated

H37Rv Rv3227 · MTBC0 mtbc0_003436 · 450 aa · 3625519–3626871 (+) · RefSeq NP_217744.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-phosphoshikimate 1-carboxyvinyltransferase
MTBC0 PGAP re-annotation3-phosphoshikimate 1-carboxyvinyltransferase
Revised (this work)3-phosphoshikimate 1-carboxyvinyltransferase. Pfam: EPSP_synthase (PF00275.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPY5 SwissProt · reviewed · Evidence at protein level
UniProt name3-phosphoshikimate 1-carboxyvinyltransferase
EC (curated) EC 2.5.1.19
Curated functionCatalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namearoA
eggNOG descriptionCatalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3- phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate
Orthologous groupCOG0128
EC number EC 2.5.1.19
KEGG orthology K00800
KEGG pathways map00400, map01100, map01110, map01130, map01230
KEGG modules M00022
Gene Ontology (35) GO:0003674, GO:0003824, GO:0003866, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082, GO:0008150, GO:0008152 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.401 · purifying
Polymorphic sites (≥ 0.1% of strains) 9 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EPSP_synthasePF00275.26 1.9e-1198–417 EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aroF (chorismate synthase), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2540c aroF chorismate synthase 995 989 ctx cooccurence:508 coexpression:770 database:900 textmining:561
Rv2552c aroE shikimate 5-dehydrogenase 995 987 ctx fusion:898 cooccurence:637 coexpression:646 textmining:657
Rv2538c aroB 3-dehydroquinate synthase 992 986 ctx fusion:900 cooccurence:645 coexpression:580 textmining:510
Rv2539c aroK shikimate kinase 988 977 ctx cooccurence:562 coexpression:471 database:900 textmining:529
Rv1712 cmk cytidylate kinase 923 913 ctx fusion:896
Rv3228 rsgA hyp hypothetical protein 948 904 ctx neighborhood:882 textmining:485
Rv3226c hyp hypothetical protein 886 788 ctx neighborhood:787 textmining:485
Rv3754 tyrA prephenate dehydrogenase TyrA 763 691 coexpression:648
Rv3859c gltB glutamate synthase large subunit 686 687 coexpression:647
Rv0948c chorismate mutase 716 678 coexpression:660
Rv1885c chorismate mutase 716 678 coexpression:660
Rv0884c serC phosphoserine aminotransferase 733 677 coexpression:650
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 683 639 coexpression:435
Rv1600 hisC1 histidinol-phosphate aminotransferase 598 542 coexpression:404
Rv3772 hisC2 histidinol-phosphate aminotransferase 543 494 coexpression:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-phosphoshikimate 1-carboxyvinyltransferase
  • MTBC0 PGAP product: 3-phosphoshikimate 1-carboxyvinyltransferase
  • Pfam (hmmscan --cut_ga): EPSP_synthase PF00275.26 (E=2e-119)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217744.1)
  • Domains: Pfam-A via hmmscan --cut_ga — EPSP_synthase (PF00275.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0128
  • Curated reference: UniProt P9WPY5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor aroF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003436|Rv3227|aroA
MKTWPAPTAPTPVRATVTVPGSKSQTNRALVLAALAAAQGRGASTISGALRSRDTELMLDALQTLGLRVDGVGSELTVSGRIEPGPGARVDCGLAGTVLRFVPPLAALGSVPVTFDGDQQARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAAVVSGGTVRITGWPRVSVQPADHILAILRQLNAVVIHADSSLEVRGPTGYDGFDVDLRAVGELTPSVAALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCRETPDGLVITATPLRPGIWRAYADHRMAMAGAIIGLRVAGVEVDDIAATTKTLPEFPRLWAEMVGPGQGWGYPQPRSGQRARRATGQGSGG