Rv2541 Still unknown · low auto-curated

H37Rv Rv2541 · MTBC0 - · 135 aa · 2864427–2864834 (+) · RefSeq NP_217057.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3zbh-assembly1_B Geobacillus thermodenitrificans EsxA crystal form I (prob 1.00, TM 0.78).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P95012 TrEMBL · unreviewed · Predicted
UniProt nameHypothetical alanine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B1B8

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.976 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 7 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.27% of strains (398) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 69.3 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3zbh-assembly1_B 1.00 0.78 1.2e-01 3zbh-assembly1_B Geobacillus thermodenitrificans EsxA crystal form I
3zbh-assembly4_E 1.00 0.79 1.7e-01 3zbh-assembly4_E Geobacillus thermodenitrificans EsxA crystal form I
3zbh-assembly3_C 1.00 0.78 3.8e-01 3zbh-assembly3_C Geobacillus thermodenitrificans EsxA crystal form I
6uuj-assembly3_H 0.95 0.74 7.6e-01 6uuj-assembly3_H Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121
3ogi-assembly1_B 0.87 0.67 1.1e+00 3ogi-assembly1_B Crystal structure of the Mycobacterium tuberculosis H37Rv EsxOP complex (Rv2346c-Rv2347c)
8qae-assembly2_C-2 0.69 0.67 2.0e+00 8qae-assembly2_C-2 X-ray crystal structure of a de novo designed single-chain antiparallel 6-helix alpha-helical barrel, sc-apCC-6-SLLA
2gl2-assembly2_B 0.28 0.56 3.1e+00 2gl2-assembly2_B Crystal structure of the tetra mutant (T66G,R67G,F68G,Y69G) of bacterial adhesin FadA
3etx-assembly2_B 0.10 0.50 7.5e+00 3etx-assembly2_B Crystal structure of bacterial adhesin FadA L14A mutant

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aroF (chorismate synthase), medium confidence from genomic context alone (score 575 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2540c aroF chorismate synthase 575 575 ctx neighborhood:569
Rv2539c aroK shikimate kinase 573 573 ctx neighborhood:569
Rv2538c aroB 3-dehydroquinate synthase 570 570 ctx neighborhood:569
Rv2537c aroD 3-dehydroquinate dehydratase 570 570 ctx neighborhood:569
Rv2542 hyp hypothetical protein 429 430 ctx neighborhood:426
Rv3224 iron-regulated short-chain dehydrogenase/reductase 434 46 textmining:432
Rv0991c hyp hypothetical protein 642 44 textmining:641
Rv3729 transferase 870 42 textmining:870
Rv2012 hyp hypothetical protein 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 3zbh-assembly1_B Geobacillus thermodenitrificans EsxA crystal form I (prob 1.00, E=1e-01, TM=0.78)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217057.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B1B8
  • Curated reference: UniProt P95012 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 69.3, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor aroF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2541|
MRRRRPPHVNAPTPCDRGDVRPPGCPASIPGVEVAGGTRARLRVTADGLQALAGRCATLAGELSAAVAPSGAVLSWQANAVAVNAAHARAGAAAAAVSARMRATAAALGQAARRYAGQDTAAAAALGAVRPWGTH