vapB17 Family assigned · medium auto-curated

H37Rv Rv2526 · MTBC0 mtbc0_002690 · 75 aa · 2873981–2874208 (+) · RefSeq NP_217042.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB17
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapB family antitoxin
Revised (this work)Type II toxin-antitoxin system VapB family antitoxin. Pfam: VapB_antitoxin (PF09957.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ49 SwissProt · reviewed · Evidence at protein level
UniProt namePutative antitoxin VapB17
Curated functionPutative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC17.

UniProt still lists this protein as Putative antitoxin VapB17; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBacterial antitoxin of type II TA system, VapB
Orthologous group2EV0F

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 26.12% of strains (37931) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VapB_antitoxinPF09957.16 2.5e-074–44 Bacterial antitoxin of type II TA system, VapB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC17 (ribonuclease VapC17), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2527 vapC17 ribonuclease VapC17 887 887 ctx neighborhood:882
Rv0656c vapC6 ribonuclease VapC6 655 51 textmining:652
Rv0549c vapC3 ribonuclease VapC3 515 51 textmining:510
Rv1655 argD acetylornithine aminotransferase 513 47 textmining:510
Rv1657 argR arginine repressor 443 47 textmining:440
Rv1653 argJ bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase 441 47 textmining:438
Rv2819c csm5 CRISPR type III-associated RAMP protein Csm5 440 47 textmining:437
Rv1659 argH argininosuccinate lyase 438 47 textmining:435
Rv0624 vapC30 ribonuclease VapC30 439 46 textmining:437
Rv2653c toxin 437 45 textmining:435
Rv2494 vapC38 ribonuclease VapC38 432 45 textmining:430
Rv0748 vapB31 antitoxin VapB31 657 44 textmining:656
Rv1720c vapC12 ribonuclease VapC12 628 44 textmining:627
Rv1397c vapC10 ribonuclease VapC10 625 44 textmining:624
Rv3408 vapC47 ribonuclease VapC47 545 44 textmining:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB17
  • MTBC0 PGAP product: type II toxin-antitoxin system VapB family antitoxin
  • Pfam (hmmscan --cut_ga): VapB_antitoxin PF09957.16 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217042.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VapB_antitoxin (PF09957.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EV0F
  • Curated reference: UniProt P9WJ49 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor vapC17
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002690|Rv2526|vapB17
MTVKRTTIELDEDLVRAAQAVTGETLRATVERALQQLVAAAAEQAAARRRRIVDHLAHAGTHVDADVLLSEQAWR