lipP Family assigned · medium auto-curated

H37Rv Rv2463 · MTBC0 mtbc0_002624 · 394 aa · 2789903–2791087 (+) · RefSeq NP_216979.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)esterase/lipase LipP
MTBC0 PGAP re-annotationserine hydrolase domain-containing protein
Revised (this work)Serine hydrolase domain-containing protein. Pfam: Beta-lactamase (PF00144.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53190 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable esterase/lipase LipP

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namelipP
eggNOG descriptionbeta-lactamase
Orthologous groupCOG1680

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.045 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 22 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Beta-lactamasePF00144.30 7.9e-7329–378 Beta-lactamase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tig (trigger factor), medium confidence from genomic context alone (score 429 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1367c hyp hypothetical protein 680 680 ctx cooccurence:678
Rv3633 hyp hypothetical protein 501 501 ctx cooccurence:494
Rv2462c tig trigger factor 591 429 ctx neighborhood:412
Rv3775 lipE lipase LipE 541 313
Rv1497 lipL esterase LipL 484 284
Rv1923 lipD lipase LipD 459 268
Rv1075c hyp hypothetical protein 660 60 textmining:654
Rv1076 lipU lipase LipU 487 57 textmining:479
Rv3510c hyp hypothetical protein 494 51 textmining:489
Rv1834 lipZ hydrolase 667 49 textmining:664
Rv3203 lipV lipase LipV 656 49 textmining:654

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: esterase/lipase LipP
  • MTBC0 PGAP product: serine hydrolase domain-containing protein
  • Pfam (hmmscan --cut_ga): Beta-lactamase PF00144.30 (E=8e-73)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216979.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Beta-lactamase (PF00144.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1680
  • Curated reference: UniProt O53190 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor tig
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002624|Rv2463|lipP
MNQPDIKGSCASEFTKVRDAFERNFVLRNEVGAAVAVWVDGDLVVNLWGGSADAGGTRPWQHDTLATVLSGTKALTATCVHQLVDRGELDLHAPVARYWPEFGQAGKQAITLAMVMSHRSGAIGPRGRLGWEQVADWDFVCEQLAAAEPWWQPGAAQGYHMTTFGFILGEVFRRVTGRTVGQYLRTEIAEPLGADVHIGLHPGEQLRCADLVDKPHIRQLLADVQAPGYPTSLNEHPKAALSVSMGFAPDDELGSNDLQLWRQIEFPGTNGQVSALGLATFYNGLAQEKLLSREHMELVRVSQGGFDTDLVLGPRVADHGWGLGYMLNQRGVNGPNPRIFGHGGLGGSFGFVDLEHRIGYAYVMNRFDATKANADPRSVVLSNEVYAALGVNRS