Rv2464c Family assigned · medium auto-curated
H37Rv Rv2464c · MTBC0 mtbc0_002625 ·
268 aa ·
2791107–2791913 MTBC0
(-) ·
RefSeq NP_216980.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | DNA glycosylase |
|---|---|
| MTBC0 PGAP re-annotation | Fpg/Nei family DNA glycosylase |
| Revised (this work) | Fpg/Nei family DNA glycosylase. Pfam: Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20), zf-FPG_IleRS (PF06827.21). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.94 (95% CI -1.63 to 4.07). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Hydrolyses DNA (this enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents). |
|---|---|
| Mycobrowser EC |
3.2.2.-, 4.2.99.18
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2491c
· 99.6% identity |
|---|---|
| M. marinum |
MMAR_3812
· 81.3% identity |
| M. smegmatis |
MSMEG_4683
· 73.1% identity |
| M. orygis |
RJtmp_002549
· 99.6% identity |
| M. abscessus |
MAB_1575
· 67.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNB9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Endonuclease 8 1 |
| EC (curated) |
EC 3.2.2.-, EC 4.2.99.18
|
| Curated function | Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. DNA glycosylase that recognizes and removes damaged pyrimidines. Excises Tg:A (thymine glycol, prefers 5R isomers), Tg:G, 5,6-dihydrouracil:G base pairs and urea:A, also excises oxidized purine derivatives guanidinohydantoin:C and spiroiminodihydantoin:C. Poorly cleaves dsDNA with uracil substitutions, thus also acting as a weak uracil-DNA glycosylase. Acts on DNA bubble and 3'-fork structures, suggesting a role in replication-associated DNA repair. Activity on 7,8-dihydro-8-oxoguanine (8-oxoG) is debated; a r. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | nei1 |
| eggNOG description | Belongs to the FPG family |
| Orthologous group | COG0266 |
| EC number |
EC 3.2.2.23, EC 4.2.99.18
|
| KEGG orthology |
K05522, K10563
|
| KEGG pathways |
map03410
|
| Gene Ontology (47) |
GO:0000702, GO:0000703, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003697, GO:0003824, GO:0003906, GO:0004844, GO:0005488, GO:0006139 +35 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.295 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.118
· 21 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.118) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 79.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 52.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 229.727272727. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 5.4 ppm · rank 2912/3519 (17.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 268 aa |
|---|---|
| Molecular weight | 29.7 kDa |
| Theoretical pI | 9.88 |
| GRAVY | -0.336 (hydrophilic) |
| Aliphatic index | 81.5 |
| Aromaticity | 0.075 |
| Instability index | 42.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fapy_DNA_glyco | PF01149.30 | 2.4e-08 | 1–94 | Formamidopyrimidine-DNA glycosylase N-terminal domain |
H2TH | PF06831.20 | 1.1e-27 | 126–214 | Formamidopyrimidine-DNA glycosylase H2TH domain |
zf-FPG_IleRS | PF06827.21 | 9.3e-06 | 240–267 | Zinc finger found in FPG and IleRS |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2opf-assembly1_A |
1.00 | 0.86 | 1.2e-23 sig | 2opf-assembly1_A Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (R252A) in complex with AP-site containing DNA substrate |
6fbu-assembly1_A |
1.00 | 0.86 | 1.2e-22 sig | 6fbu-assembly1_A Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (E2Q) in complex with AP-site containing DNA substrate |
1k3x-assembly1_A |
1.00 | 0.85 | 7.2e-23 sig | 1k3x-assembly1_A Crystal structure of a trapped reaction intermediate of the DNA repair enzyme Endonuclease VIII with Brominated-DNA |
1k3w-assembly1_A |
1.00 | 0.85 | 1.0e-22 sig | 1k3w-assembly1_A Crystal structure of a trapped reaction intermediate of the DNA Repair Enzyme Endonuclease VIII with DNA |
8tjg-assembly1_A |
1.00 | 0.85 | 4.3e-22 sig | 8tjg-assembly1_A Structure of Nei2 from Mycobacterium smegmatis in complex with Zn2+ |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | lipP (+ strand, 19 bp gap) |
|---|---|
| Downstream (3' on genome) | rpiB (- strand, 5 bp gap) |
| Predicted operon |
Rv2464c · rpiB
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1990c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rpiB (ribose-5-phosphate isomerase B), high confidence from genomic context alone (score 884 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3297 nei exp |
endonuclease VIII | 924 | 924 | database:900 |
Rv2465c rpiB |
ribose-5-phosphate isomerase B | 884 | 884 ctx | neighborhood:882 |
Rv1629 polA |
DNA polymerase I | 865 | 816 | coexpression:791 |
Rv2466c hyp |
hypothetical protein | 801 | 802 ctx | neighborhood:773 |
Rv2467 pepN |
aminopeptidase PepN | 715 | 715 ctx | neighborhood:701 |
Rv1631 coaE |
dephospho-CoA kinase CoaE | 554 | 512 | coexpression:470 |
Rv2090 |
5'-3' exonuclease | 484 | 451 | coexpression:433 |
Rv1156 hyp |
hypothetical protein | 448 | 417 | coexpression:417 |
Rv3674c nth |
endonuclease III | 887 | 416 | coexpression:416 textmining:815 |
Rv1870c hyp |
hypothetical protein | 448 | 416 | coexpression:416 |
Rv2924c fpg |
formamidopyrimidine-DNA glycosylase | 570 | 321 | |
Rv0944 fpg2 |
formamidopyrimidine-DNA glycosylase | 428 | 282 | |
Rv2737c recA |
recombinase A | 608 | 253 | textmining:497 |
Rv3296 lhr |
ATP-dependent helicase | 860 | 191 | textmining:835 |
Rv3589 mutY |
A/G-specific adenine glycosylase | 839 | 126 | textmining:824 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: DNA glycosylase
- MTBC0 PGAP product: Fpg/Nei family DNA glycosylase
- Pfam (hmmscan --cut_ga): Fapy_DNA_glyco PF01149.30 (E=2e-08), H2TH PF06831.20 (E=1e-27), zf-FPG_IleRS PF06827.21 (E=9e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216980.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20), zf-FPG_IleRS (PF06827.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0266 - Curated reference: UniProt P9WNB9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
rpiB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002625|Rv2464c| MPEGHTLHRLARLHQRRFAGAPVSVSSPQGRFADSASALNGRVLRRASAWGKHLFHHYVGGPVVHVHLGLYGTFTEWARPTDGWLPEPAGQVRMRMVGAEFGTDLRGPTVCESIDDGEVADVVARLGPDPLRSDANPSSAWSRITKSRRPIGALLMDQTVIAGVGNVYRNELLFRHRIDPQRPGRGIGEPEFDAAWNDLVSLMKVGLRRGKIIVVRPEHDHGLPSYLPDRPRTYVYRRAGEPCRVCGGVIRTALLEGRNVFWCPVCQT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2464c? Email the maintainer — the message is pre-filled with this gene's details.