Rv2464c Family assigned · medium auto-curated

H37Rv Rv2464c · MTBC0 mtbc0_002625 · 268 aa · 2791107–2791913 (-) · RefSeq NP_216980.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA glycosylase
MTBC0 PGAP re-annotationFpg/Nei family DNA glycosylase
Revised (this work)Fpg/Nei family DNA glycosylase. Pfam: Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20), zf-FPG_IleRS (PF06827.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNB9 SwissProt · reviewed · Evidence at protein level
UniProt nameEndonuclease 8 1
EC (curated) EC 3.2.2.-, EC 4.2.99.18
Curated functionInvolved in base excision repair of DNA damaged by oxidation or by mutagenic agents. DNA glycosylase that recognizes and removes damaged pyrimidines. Excises Tg:A (thymine glycol, prefers 5R isomers), Tg:G, 5,6-dihydrouracil:G base pairs and urea:A, also excises oxidized purine derivatives guanidinohydantoin:C and spiroiminodihydantoin:C. Poorly cleaves dsDNA with uracil substitutions, thus also acting as a weak uracil-DNA glycosylase. Acts on DNA bubble and 3'-fork structures, suggesting a role in replication-associated DNA repair. Activity on 7,8-dihydro-8-oxoguanine (8-oxoG) is debated; a r.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namenei1
eggNOG descriptionBelongs to the FPG family
Orthologous groupCOG0266
EC number EC 3.2.2.23, EC 4.2.99.18
KEGG orthology K05522, K10563
KEGG pathways map03410
Gene Ontology (47) GO:0000702, GO:0000703, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003697, GO:0003824, GO:0003906, GO:0004844, GO:0005488, GO:0006139 +35 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.295 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fapy_DNA_glycoPF01149.30 2.4e-081–94 Formamidopyrimidine-DNA glycosylase N-terminal domain
H2THPF06831.20 1.1e-27126–214 Formamidopyrimidine-DNA glycosylase H2TH domain
zf-FPG_IleRSPF06827.21 9.3e-06240–267 Zinc finger found in FPG and IleRS

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpiB (ribose-5-phosphate isomerase B), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3297 nei endonuclease VIII 924 924 database:900
Rv2465c rpiB ribose-5-phosphate isomerase B 884 884 ctx neighborhood:882
Rv1629 polA DNA polymerase I 865 816 coexpression:791
Rv2466c hyp hypothetical protein 801 802 ctx neighborhood:773
Rv2467 pepN aminopeptidase PepN 715 715 ctx neighborhood:701
Rv1631 coaE dephospho-CoA kinase CoaE 554 512 coexpression:470
Rv2090 5'-3' exonuclease 484 451 coexpression:433
Rv1156 hyp hypothetical protein 448 417 coexpression:417
Rv3674c nth endonuclease III 887 416 coexpression:416 textmining:815
Rv1870c hyp hypothetical protein 448 416 coexpression:416
Rv2924c fpg formamidopyrimidine-DNA glycosylase 570 321
Rv0944 fpg2 formamidopyrimidine-DNA glycosylase 428 282
Rv2737c recA recombinase A 608 253 textmining:497
Rv3296 lhr ATP-dependent helicase 860 191 textmining:835
Rv3589 mutY A/G-specific adenine glycosylase 839 126 textmining:824

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: DNA glycosylase
  • MTBC0 PGAP product: Fpg/Nei family DNA glycosylase
  • Pfam (hmmscan --cut_ga): Fapy_DNA_glyco PF01149.30 (E=2e-08), H2TH PF06831.20 (E=1e-27), zf-FPG_IleRS PF06827.21 (E=9e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216980.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20), zf-FPG_IleRS (PF06827.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0266
  • Curated reference: UniProt P9WNB9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor rpiB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002625|Rv2464c|
MPEGHTLHRLARLHQRRFAGAPVSVSSPQGRFADSASALNGRVLRRASAWGKHLFHHYVGGPVVHVHLGLYGTFTEWARPTDGWLPEPAGQVRMRMVGAEFGTDLRGPTVCESIDDGEVADVVARLGPDPLRSDANPSSAWSRITKSRRPIGALLMDQTVIAGVGNVYRNELLFRHRIDPQRPGRGIGEPEFDAAWNDLVSLMKVGLRRGKIIVVRPEHDHGLPSYLPDRPRTYVYRRAGEPCRVCGGVIRTALLEGRNVFWCPVCQT