glbO Resolved · high auto-curated
H37Rv Rv2470 · MTBC0 mtbc0_002632 ·
128 aa ·
2797426–2797812 MTBC0
(+) ·
RefSeq NP_216986.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hemoglobin GlbO |
|---|---|
| MTBC0 PGAP re-annotation | group 2 truncated hemoglobin GlbO |
| Revised (this work) | Group 2 truncated hemoglobin GlbO. Pfam: Bac_globin (PF01152.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 10 publications
10 TB publications mention this gene. 10 publication(s) discuss this gene (7 in a M. tuberculosis context, 6 in other mycobacteria — M. smegmatis (4), M. leprae (3)).
| Publication | Date |
|---|---|
| Transcript analysis and expression of the glbO gene, encoding truncated hemoglobin,O, of M. Smegmatis implicate its role under hypoxia and oxidative stress. doi:10.1016/j.gene.2022.146759 | 2022 |
| Truncated Hemoglobin O Carries an Autokinase Activity and Facilitates Adaptation of Mycobacterium tuberculosis Under Hypoxia. doi:10.1089/ars.2018.7708 | 2020 |
| Comparative analysis of mycobacterial truncated hemoglobin promoters and the groEL2 promoter in free-living and intracellular mycobacteria. doi:10.1128/AEM.01984-12 | 2012 |
| Structural determinants of ligand migration in Mycobacterium tuberculosis truncated hemoglobin O. doi:10.1002/prot.22072 | 2008 |
| Responses of Mycobacterium tuberculosis hemoglobin promoters to in vitro and in vivo growth conditions. doi:10.1128/AEM.02663-07 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | aglA (Rv2471, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
1 reported modified residue(s):
3',4'-dihydroxyphenylalanine; alternate @36.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index 0.44 (95% CI -1.13 to 3.01). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Oxygen carrier, involved in oxygen transport. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2497
· 100.0% identity |
|---|---|
| M. leprae |
ML1253c
· 88.7% identity |
| M. marinum |
MMAR_3821
· 85.2% identity |
| M. smegmatis |
MSMEG_4695
· 79.4% identity |
| M. orygis |
RJtmp_002556
· 100.0% identity |
| M. abscessus |
MAB_1566c
· 78.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WN23
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Group 2 truncated hemoglobin GlbO |
| Curated function | When expressed in E.coli and M.smegmatis, HbO increases oxygen uptake. Membrane vesicles of E.coli carrying HbO show a respiration activity about twice that of membranes without HbO. HbO seems to interact with a terminal oxidase. Therefore, HbO could participate in oxygen/electron-transfer process, suggesting a function related to the facilitation of oxygen transfer during aerobic metabolism of M.tuberculosis. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | glbO |
| eggNOG description | truncated |
| Orthologous group | COG2346 |
| KEGG orthology |
K06886
|
| Gene Ontology (26) |
GO:0003674, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0008144, GO:0008150, GO:0015669, GO:0015671, GO:0015893, GO:0016020 +14 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.953 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 61.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 13.3333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 10 (in vivo) | -5.45 | 0.0 | required |
| fitness in mouse infection, day 45 (in vivo) | -5.45 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | +4.66 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +4.26 | 0.0083 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) | -3.49 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | +3.49 | 0.0 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) | -3.35 | 0.0042 | required |
Conditional fitness of transposon-disruption mutants across 7 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 131.0 ppm · rank 1105/3519 (68.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 128 aa |
|---|---|
| Molecular weight | 14.9 kDa |
| Theoretical pI | 5.51 |
| GRAVY | -0.53 (hydrophilic) |
| Aliphatic index | 74.8 |
| Aromaticity | 0.109 |
| Instability index | 69.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Bac_globin | PF01152.28 | 1.5e-42 | 4–121 | Bacterial-like globin |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2qrw |
X-ray diffraction | 1.93 Å | 100% |
1ngk |
X-ray diffraction | 2.11 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1ngk-assembly1_B |
1.00 | 0.99 | 9.3e-18 sig | 1ngk-assembly1_B Crystallographic Structure of Mycobacterium tuberculosis Hemoglobin O |
2qrw-assembly1_B |
1.00 | 0.98 | 2.4e-17 sig | 2qrw-assembly1_B Crystal structure of Mycobacterium tuberculosis trHbO WG8F mutant |
2qrw-assembly7_J |
1.00 | 0.99 | 4.7e-17 sig | 2qrw-assembly7_J Crystal structure of Mycobacterium tuberculosis trHbO WG8F mutant |
2qrw-assembly1_H |
1.00 | 0.99 | 1.1e-16 sig | 2qrw-assembly1_H Crystal structure of Mycobacterium tuberculosis trHbO WG8F mutant |
2bmm-assembly1_A |
1.00 | 0.94 | 1.4e-10 sig | 2bmm-assembly1_A X-ray structure of a novel thermostable hemoglobin from the actinobacterium Thermobifida fusca |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2469c (- strand, 142 bp gap) |
|---|---|
| Downstream (3' on genome) | aglA (+ strand, -1 bp gap) |
| Predicted operon |
glbO · aglA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1990c (represses) · Rv3249c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: aglA (alpha-glucosidase AglA), high confidence from genomic context alone (score 950 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2471 aglA |
alpha-glucosidase AglA | 950 | 950 ctx | neighborhood:881 fusion:596 |
Rv2469c hyp |
hypothetical protein | 774 | 774 ctx | neighborhood:773 |
Rv2472 hyp |
hypothetical protein | 638 | 639 ctx | neighborhood:637 |
Rv2473 hyp |
hypothetical protein | 577 | 578 ctx | neighborhood:578 |
Rv2468A hyp |
hypothetical protein | 563 | 563 ctx | neighborhood:563 |
Rv3283 sseA |
thiosulfate sulfurtransferase SseA | 534 | 534 | coexpression:533 |
Rv2466c hyp |
hypothetical protein | 576 | 533 | coexpression:419 |
Rv2468c hyp |
hypothetical protein | 527 | 526 ctx | neighborhood:526 |
Rv0385 |
monooxygenase | 410 | 364 | |
Rv1542c glbN |
hemoglobin GlbN | 965 | 46 | textmining:965 |
Rv3568c hsaC |
extradiol dioxygenase | 442 | 46 | textmining:440 |
Rv2674 msrB |
peptide methionine sulfoxide reductase MsrB | 673 | 41 | textmining:673 |
Rv3515c fadD19 |
acyl-CoA synthetase | 440 | 41 | textmining:440 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hemoglobin GlbO
- MTBC0 PGAP product: group 2 truncated hemoglobin GlbO
- Pfam (hmmscan --cut_ga): Bac_globin PF01152.28 (E=2e-42)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216986.1)
- Domains: Pfam-A via hmmscan --cut_ga — Bac_globin (PF01152.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2346 - Curated reference: UniProt P9WN23 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
aglA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002632|Rv2470|glbO MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for glbO? Email the maintainer — the message is pre-filled with this gene's details.