glbO Resolved · high auto-curated
H37Rv Rv2470 · MTBC0 mtbc0_002632 ·
128 aa · 2797426–2797812 (+) ·
RefSeq NP_216986.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hemoglobin GlbO |
|---|---|
| MTBC0 PGAP re-annotation | group 2 truncated hemoglobin GlbO |
| Revised (this work) | Group 2 truncated hemoglobin GlbO. Pfam: Bac_globin (PF01152.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WN23
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Group 2 truncated hemoglobin GlbO |
| Curated function | When expressed in E.coli and M.smegmatis, HbO increases oxygen uptake. Membrane vesicles of E.coli carrying HbO show a respiration activity about twice that of membranes without HbO. HbO seems to interact with a terminal oxidase. Therefore, HbO could participate in oxygen/electron-transfer process, suggesting a function related to the facilitation of oxygen transfer during aerobic metabolism of M.tuberculosis. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | glbO |
| eggNOG description | truncated |
| Orthologous group | COG2346 |
| KEGG orthology |
K06886
|
| Gene Ontology (26) |
GO:0003674, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0008144, GO:0008150, GO:0015669, GO:0015671, GO:0015893, GO:0016020 +14 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.953 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Bac_globin | PF01152.28 | 1.5e-42 | 4–121 | Bacterial-like globin |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: aglA (alpha-glucosidase AglA), high confidence from genomic context alone (score 950 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2471 aglA |
alpha-glucosidase AglA | 950 | 950 ctx | neighborhood:881 fusion:596 |
Rv2469c hyp |
hypothetical protein | 774 | 774 ctx | neighborhood:773 |
Rv2472 hyp |
hypothetical protein | 638 | 639 ctx | neighborhood:637 |
Rv2473 hyp |
hypothetical protein | 577 | 578 ctx | neighborhood:578 |
Rv2468A hyp |
hypothetical protein | 563 | 563 ctx | neighborhood:563 |
Rv3283 sseA |
thiosulfate sulfurtransferase SseA | 534 | 534 | coexpression:533 |
Rv2466c hyp |
hypothetical protein | 576 | 533 | coexpression:419 |
Rv2468c hyp |
hypothetical protein | 527 | 526 ctx | neighborhood:526 |
Rv0385 |
monooxygenase | 410 | 364 | |
Rv1542c glbN |
hemoglobin GlbN | 965 | 46 | textmining:965 |
Rv3568c hsaC |
extradiol dioxygenase | 442 | 46 | textmining:440 |
Rv2674 msrB |
peptide methionine sulfoxide reductase MsrB | 673 | 41 | textmining:673 |
Rv3515c fadD19 |
acyl-CoA synthetase | 440 | 41 | textmining:440 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hemoglobin GlbO
- MTBC0 PGAP product: group 2 truncated hemoglobin GlbO
- Pfam (hmmscan --cut_ga): Bac_globin PF01152.28 (E=2e-42)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216986.1)
- Domains: Pfam-A via hmmscan --cut_ga — Bac_globin (PF01152.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2346 - Curated reference: UniProt P9WN23 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
aglA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002632|Rv2470|glbO MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF