Rv3716c Family assigned · medium auto-curated

H37Rv Rv3716c · MTBC0 mtbc0_003939 · 133 aa · 4184633–4185034 (-) · RefSeq NP_218233.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationYbaB/EbfC family nucleoid-associated protein
Revised (this work)YbaB/EbfC family nucleoid-associated protein. Pfam: YbaB_DNA_bd (PF02575.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNR9 SwissProt · reviewed · Evidence at protein level
UniProt nameNucleoid-associated protein Rv3716c
Curated functionBinds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameybaB
eggNOG descriptionBinds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection
Orthologous groupCOG0718
KEGG orthology K09747
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YbaB_DNA_bdPF02575.22 1.2e-3112–100 YbaB/EbfC DNA-binding family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: recR (recombination protein RecR), high confidence from genomic context alone (score 973 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3715c recR recombination protein RecR 983 973 ctx neighborhood:876 coexpression:792
Rv2460c clpP2 ATP-dependent CLP protease proteolytic subunit 2 809 777 coexpression:770
Rv3717 hyp hypothetical protein 776 776 ctx neighborhood:775
Rv3714c hyp hypothetical protein 627 627 ctx neighborhood:625
Rv3721c dnaZX DNA polymerase III subunit gamma/tau 575 535 coexpression:422
Rv2842c rimP ribosome maturation factor RimP 514 515 coexpression:410
Rv1307 atpH ATP synthase subunit b/delta 463 464 coexpression:448
Rv3443c rplM 50S ribosomal protein L13 450 450 coexpression:432
Rv3644c DNA polymerase 487 439 coexpression:420
Rv3709c ask aspartokinase 434 435
Rv0652 rplL 50S ribosomal protein L7/L12 432 432 coexpression:414
Rv2457c clpX ATP-dependent CLP protease ATP-binding subunit ClpX 420 421
Rv1901 cinA competence damage-inducible protein CinA 416 415
Rv0714 rplN 50S ribosomal protein L14 403 403
Rv2461c clpP1 ATP-dependent CLP protease proteolytic subunit 1 465 384

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: YbaB/EbfC family nucleoid-associated protein
  • Pfam (hmmscan --cut_ga): YbaB_DNA_bd PF02575.22 (E=1e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218233.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YbaB_DNA_bd (PF02575.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0718
  • Curated reference: UniProt P9WNR9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor recR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003939|Rv3716c|
MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI