glnA2 Family assigned · medium auto-curated

H37Rv Rv2222c · MTBC0 mtbc0_002359 · 446 aa · 2518559–2519899 MTBC0 (-) · RefSeq NP_216738.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamine synthetase
MTBC0 PGAP re-annotationglutamine synthetase family protein
Revised (this work)Glutamine synthetase family protein. Pfam: Gln-synt_N (PF03951.25), Gln-synt_C (PF00120.30).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 6 publications

6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).

Most recent 5 of 6.
PublicationDate
The Unexpected Essentiality of glnA2 in Mycobacterium smegmatis Is Salvaged by Overexpression of the Global Nitrogen Regulator glnR, but Not by L-, D- or Iso-Glutamine. doi:10.3389/fmicb.2018.02143 2018
Glutamine synthetase sequence evolution in the mycobacteria and their use as molecular markers for Actinobacteria speciation. doi:10.1186/1471-2148-9-48 2009
Independent transcription of glutamine synthetase (glnA2) and glutamine synthetase adenylyltransferase (glnE) in Mycobacterium bovis and Mycobacterium tuberculosis. doi:10.1016/j.tube.2008.02.006 2008
Identification of the Mycobacterium tuberculosis GlnE promoter and its response to nitrogen availability. doi:10.1099/mic.0.28942-0 2006
All four Mycobacterium tuberculosis glnA genes encode glutamine synthetase activities but only GlnA1 is abundantly expressed and essential for bacterial homeostasis. doi:10.1111/j.1365-2958.2005.04899.x 2005

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.42 (95% CI -1.76 to 3.81). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in glutamine biosynthesis [catalytic activity: ATP + L-glutamate + NH(3) = ADP + glutamine + orthophosphate].
Mycobrowser EC 6.3.1.2 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2246c · 100.0% identity
M. leprae ML1631c · 93.3% identity
M. marinum MMAR_3294 · 93.9% identity
M. smegmatis MSMEG_4294 · 88.8% identity
M. orygis RJtmp_002294 · 100.0% identity
M. abscessus MAB_1920 · 85.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WN37 SwissProt · reviewed · Evidence at protein level
UniProt nameGlutamine synthetase
EC (curated) EC 6.3.1.2
Curated functionGlutamine synthetase (GS) catalyzes the ATP-dependent biosynthesis of glutamine from glutamate and ammonia. May function as a transcription coregulator and in the regulation of genes involved in nitrogen metabolism.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameglnA2
eggNOG descriptionglutamine synthetase
Orthologous groupCOG0174
EC number EC 6.3.1.2
KEGG orthology K01915
KEGG pathways map00220, map00250, map00630, map00910, map01100, map01120, map01230, map02020, map04217, map04724, map04727
Gene Ontology (12) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0016787, GO:0016810, GO:0016811, GO:0044464, GO:0050001, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.479 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 93.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 67.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 21 in the ORF — 0 in the essential state, 0 growth-defect, 21 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 54.619047619. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
All 21 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
altered fitness under Isoniazid (drug exposure) +4.650.0 disruption advantageous
fitness in mouse infection, day 10 (in vivo) -4.140.0 required
fitness in mouse infection (in vivo) +3.100.0 disruption advantageous
fitness in mouse infection, day 45 (in vivo) -2.650.029 required
fitness in mouse infection (in vivo) +1.620.0 disruption advantageous
fitness in mouse infection (in vivo) +1.560.028 disruption advantageous
fitness in mouse infection (in vivo) +1.540.0 disruption advantageous
altered fitness under nitrosative (NO) stress (stress) -1.400.048 required
Mutants exhibiting altered fitness in the absence of gene marP (other) +1.070.002 disruption advantageous

Conditional fitness of transposon-disruption mutants across 9 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance694.0 ppm · rank 318/3519 (91.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length446 aa
Molecular weight49.6 kDa
Theoretical pI5.29
GRAVY-0.255 (hydrophilic)
Aliphatic index76.4
Aromaticity0.101
Instability index48.8 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Gln-synt_NPF03951.25 1.5e-2716–100 Glutamine synthetase, beta-Grasp domain
Gln-synt_CPF00120.30 4.1e-127107–443 Glutamine synthetase, catalytic domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.3

PDB hitprobTM-scoreE-valueDescription
8ufj-assembly1_B 1.00 0.95 3.4e-53 sig 8ufj-assembly1_B Structure of M. mazei GS(R167L-A168G) apo form
8oox-assembly1_B 1.00 0.95 4.5e-52 sig 8oox-assembly1_B Glutamine synthetase from Methermicoccus shengliensis at a resolution of 3.09 A
7tfa-assembly1_B 1.00 0.95 1.2e-51 sig 7tfa-assembly1_B P. polymyxa GS(12)-Q-GlnR peptide
8oox-assembly1_A 1.00 0.95 2.2e-51 sig 8oox-assembly1_A Glutamine synthetase from Methermicoccus shengliensis at a resolution of 3.09 A
8ooz-assembly1_E 1.00 0.96 5.0e-51 sig 8ooz-assembly1_E Glutamine synthetase from Methermicoccus shengliensis in complex with MgATP at 2.7 A resolution

Foldseek search of the AlphaFold DB model (mean pLDDT 93.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)glnE (- strand, 48 bp gap)
Downstream (3' on genome)Rv2223c (- strand, 94 bp gap)
Predicted operon glnE · glnA2

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (3 TF) Rv0324 (represses) · Rv1353c (represses) · kstR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a physiological-context lead, not a function.

Condition: Condition-blind by construction. These edges come from transcription-factor OVEREXPRESSION in a single laboratory condition, so a listed regulator is not a claim that it governs this gene in every circumstance. Measured counter-examples exist within this atlas (see Rv2516c, where the DosR regulon collapses under moxifloxacin while the gene itself rises). Read a regulator as 'capable of shifting this gene', and look for the condition before building a hypothesis on it.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: gltB (glutamate synthase large subunit), high confidence from genomic context alone (score 970 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3859c gltB exp glutamate synthase large subunit 985 970 ctx neighborhood:456 coexpression:500 database:900 textmining:519
Rv3436c glmS exp glucosamine--fructose-6-phosphate aminotransferase 930 924 database:900
Rv1383 carA exp carbamoyl-phosphate synthase small subunit 923 919 database:900
Rv1384 carB exp carbamoyl-phosphate synthase large subunit 923 917 database:900
Rv3858c gltD exp glutamate synthase small subunit 917 913 database:900
Rv0808 purF exp amidophosphoribosyltransferase 912 905 database:900
Rv1187 rocA exp pyrroline-5-carboxylate dehydrogenase RocA 910 905 database:900
Rv0252 nirB exp nitrite reductase large subunit NirB 941 904 database:900 textmining:411
Rv3432c gadB exp glutamate decarboxylase GadB 917 904 database:900
Rv0253 nirD exp nitrite reductase small subunit NirD 924 902 database:900
Rv0788 purQ exp phosphoribosylformylglycinamidine synthase 910 902 database:900
Rv2476c gdh exp NAD-dependent glutamate dehydrogenase 941 901 database:900 textmining:431
Rv1879 hyp hypothetical protein 893 893 ctx fusion:889
Rv1878 glnA3 exp glutamine synthetase GlnA 869 858 database:800
Rv2860c glnA4 exp glutamine synthetase 861 849 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamine synthetase
  • MTBC0 PGAP product: glutamine synthetase family protein
  • Pfam (hmmscan --cut_ga): Gln-synt_N PF03951.25 (E=2e-27), Gln-synt_C PF00120.30 (E=4e-127)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216738.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Gln-synt_N (PF03951.25), Gln-synt_C (PF00120.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0174
  • Curated reference: UniProt P9WN37 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor gltB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002359|Rv2222c|glnA2
MDRQKEFVLRTLEERDIRFVRLWFTDVLGFLKSVAIAPAELEGAFEEGIGFDGSSIEGFARVSESDTVAHPDPSTFQVLPWATSSGHHHSARMFCDITMPDGSPSWADPRHVLRRQLTKAGELGFSCYVHPEIEFFLLKPGPEDGSVPVPVDNAGYFDQAVHDSALNFRRHAIDALEFMGISVEFSHHEGAPGQQEIDLRFADALSMADNVMTFRYVIKEVALEEGARASFMPKPFGQHPGSAMHTHMSLFEGDVNAFHSADDPLQLSEVGKSFIAGILEHACEISAVTNQWVNSYKRLVQGGEAPTAASWGAANRSALVRVPMYTPHKTSSRRVEVRSPDSACNPYLTFAVLLAAGLRGVEKGYVLGPQAEDNVWDLTPEERRAMGYRELPSSLDSALRAMEASELVAEALGEHVFDFFLRNKRTEWANYRSHVTPYELRTYLSL