glnA2 Family assigned · medium auto-curated
H37Rv Rv2222c · MTBC0 mtbc0_002359 ·
446 aa ·
2518559–2519899 MTBC0
(-) ·
RefSeq NP_216738.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glutamine synthetase |
|---|---|
| MTBC0 PGAP re-annotation | glutamine synthetase family protein |
| Revised (this work) | Glutamine synthetase family protein. Pfam: Gln-synt_N (PF03951.25), Gln-synt_C (PF00120.30). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).
| Publication | Date |
|---|---|
| The Unexpected Essentiality of glnA2 in Mycobacterium smegmatis Is Salvaged by Overexpression of the Global Nitrogen Regulator glnR, but Not by L-, D- or Iso-Glutamine. doi:10.3389/fmicb.2018.02143 | 2018 |
| Glutamine synthetase sequence evolution in the mycobacteria and their use as molecular markers for Actinobacteria speciation. doi:10.1186/1471-2148-9-48 | 2009 |
| Independent transcription of glutamine synthetase (glnA2) and glutamine synthetase adenylyltransferase (glnE) in Mycobacterium bovis and Mycobacterium tuberculosis. doi:10.1016/j.tube.2008.02.006 | 2008 |
| Identification of the Mycobacterium tuberculosis GlnE promoter and its response to nitrogen availability. doi:10.1099/mic.0.28942-0 | 2006 |
| All four Mycobacterium tuberculosis glnA genes encode glutamine synthetase activities but only GlnA1 is abundantly expressed and essential for bacterial homeostasis. doi:10.1111/j.1365-2958.2005.04899.x | 2005 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.42 (95% CI -1.76 to 3.81). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in glutamine biosynthesis [catalytic activity: ATP + L-glutamate + NH(3) = ADP + glutamine + orthophosphate]. |
|---|---|
| Mycobrowser EC |
6.3.1.2
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2246c
· 100.0% identity |
|---|---|
| M. leprae |
ML1631c
· 93.3% identity |
| M. marinum |
MMAR_3294
· 93.9% identity |
| M. smegmatis |
MSMEG_4294
· 88.8% identity |
| M. orygis |
RJtmp_002294
· 100.0% identity |
| M. abscessus |
MAB_1920
· 85.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WN37
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glutamine synthetase |
| EC (curated) |
EC 6.3.1.2
|
| Curated function | Glutamine synthetase (GS) catalyzes the ATP-dependent biosynthesis of glutamine from glutamate and ammonia. May function as a transcription coregulator and in the regulation of genes involved in nitrogen metabolism. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | glnA2 |
| eggNOG description | glutamine synthetase |
| Orthologous group | COG0174 |
| EC number |
EC 6.3.1.2
|
| KEGG orthology |
K01915
|
| KEGG pathways |
map00220, map00250, map00630, map00910, map01100, map01120, map01230, map02020, map04217, map04724, map04727
|
| Gene Ontology (12) |
GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0016787, GO:0016810, GO:0016811, GO:0044464, GO:0050001, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.479 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 93.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 67.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) |
21 in the ORF —
0 in the essential state,
0 growth-defect,
21 non-essential,
0 growth-advantage.
Saturation 1.000,
mean read count 54.619047619.
A region of the protein devoid of TA sites is invisible to this assay: nothing can be
inferred about it, in either direction.
All 21 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Isoniazid (drug exposure) | +4.65 | 0.0 | disruption advantageous |
| fitness in mouse infection, day 10 (in vivo) | -4.14 | 0.0 | required |
| fitness in mouse infection (in vivo) | +3.10 | 0.0 | disruption advantageous |
| fitness in mouse infection, day 45 (in vivo) | -2.65 | 0.029 | required |
| fitness in mouse infection (in vivo) | +1.62 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.56 | 0.028 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.54 | 0.0 | disruption advantageous |
| altered fitness under nitrosative (NO) stress (stress) | -1.40 | 0.048 | required |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | +1.07 | 0.002 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 9 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 694.0 ppm · rank 318/3519 (91.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 446 aa |
|---|---|
| Molecular weight | 49.6 kDa |
| Theoretical pI | 5.29 |
| GRAVY | -0.255 (hydrophilic) |
| Aliphatic index | 76.4 |
| Aromaticity | 0.101 |
| Instability index | 48.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Gln-synt_N | PF03951.25 | 1.5e-27 | 16–100 | Glutamine synthetase, beta-Grasp domain |
Gln-synt_C | PF00120.30 | 4.1e-127 | 107–443 | Glutamine synthetase, catalytic domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8ufj-assembly1_B |
1.00 | 0.95 | 3.4e-53 sig | 8ufj-assembly1_B Structure of M. mazei GS(R167L-A168G) apo form |
8oox-assembly1_B |
1.00 | 0.95 | 4.5e-52 sig | 8oox-assembly1_B Glutamine synthetase from Methermicoccus shengliensis at a resolution of 3.09 A |
7tfa-assembly1_B |
1.00 | 0.95 | 1.2e-51 sig | 7tfa-assembly1_B P. polymyxa GS(12)-Q-GlnR peptide |
8oox-assembly1_A |
1.00 | 0.95 | 2.2e-51 sig | 8oox-assembly1_A Glutamine synthetase from Methermicoccus shengliensis at a resolution of 3.09 A |
8ooz-assembly1_E |
1.00 | 0.96 | 5.0e-51 sig | 8ooz-assembly1_E Glutamine synthetase from Methermicoccus shengliensis in complex with MgATP at 2.7 A resolution |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | glnE (- strand, 48 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2223c (- strand, 94 bp gap) |
| Predicted operon |
glnE · glnA2
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0324 (represses) · Rv1353c (represses) · kstR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a physiological-context lead, not a function.
Condition: Condition-blind by construction. These edges come from transcription-factor OVEREXPRESSION in a single laboratory condition, so a listed regulator is not a claim that it governs this gene in every circumstance. Measured counter-examples exist within this atlas (see Rv2516c, where the DosR regulon collapses under moxifloxacin while the gene itself rises). Read a regulator as 'capable of shifting this gene', and look for the condition before building a hypothesis on it.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: gltB (glutamate synthase large subunit), high confidence from genomic context alone (score 970 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3859c gltB exp |
glutamate synthase large subunit | 985 | 970 ctx | neighborhood:456 coexpression:500 database:900 textmining:519 |
Rv3436c glmS exp |
glucosamine--fructose-6-phosphate aminotransferase | 930 | 924 | database:900 |
Rv1383 carA exp |
carbamoyl-phosphate synthase small subunit | 923 | 919 | database:900 |
Rv1384 carB exp |
carbamoyl-phosphate synthase large subunit | 923 | 917 | database:900 |
Rv3858c gltD exp |
glutamate synthase small subunit | 917 | 913 | database:900 |
Rv0808 purF exp |
amidophosphoribosyltransferase | 912 | 905 | database:900 |
Rv1187 rocA exp |
pyrroline-5-carboxylate dehydrogenase RocA | 910 | 905 | database:900 |
Rv0252 nirB exp |
nitrite reductase large subunit NirB | 941 | 904 | database:900 textmining:411 |
Rv3432c gadB exp |
glutamate decarboxylase GadB | 917 | 904 | database:900 |
Rv0253 nirD exp |
nitrite reductase small subunit NirD | 924 | 902 | database:900 |
Rv0788 purQ exp |
phosphoribosylformylglycinamidine synthase | 910 | 902 | database:900 |
Rv2476c gdh exp |
NAD-dependent glutamate dehydrogenase | 941 | 901 | database:900 textmining:431 |
Rv1879 hyp |
hypothetical protein | 893 | 893 ctx | fusion:889 |
Rv1878 glnA3 exp |
glutamine synthetase GlnA | 869 | 858 | database:800 |
Rv2860c glnA4 exp |
glutamine synthetase | 861 | 849 | database:800 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glutamine synthetase
- MTBC0 PGAP product: glutamine synthetase family protein
- Pfam (hmmscan --cut_ga): Gln-synt_N PF03951.25 (E=2e-27), Gln-synt_C PF00120.30 (E=4e-127)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216738.1)
- Domains: Pfam-A via hmmscan --cut_ga — Gln-synt_N (PF03951.25), Gln-synt_C (PF00120.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0174 - Curated reference: UniProt P9WN37 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
66 functional partner(s); context anchor
gltB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002359|Rv2222c|glnA2 MDRQKEFVLRTLEERDIRFVRLWFTDVLGFLKSVAIAPAELEGAFEEGIGFDGSSIEGFARVSESDTVAHPDPSTFQVLPWATSSGHHHSARMFCDITMPDGSPSWADPRHVLRRQLTKAGELGFSCYVHPEIEFFLLKPGPEDGSVPVPVDNAGYFDQAVHDSALNFRRHAIDALEFMGISVEFSHHEGAPGQQEIDLRFADALSMADNVMTFRYVIKEVALEEGARASFMPKPFGQHPGSAMHTHMSLFEGDVNAFHSADDPLQLSEVGKSFIAGILEHACEISAVTNQWVNSYKRLVQGGEAPTAASWGAANRSALVRVPMYTPHKTSSRRVEVRSPDSACNPYLTFAVLLAAGLRGVEKGYVLGPQAEDNVWDLTPEERRAMGYRELPSSLDSALRAMEASELVAEALGEHVFDFFLRNKRTEWANYRSHVTPYELRTYLSL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for glnA2? Email the maintainer — the message is pre-filled with this gene's details.