lipA Resolved · high auto-curated
H37Rv Rv2218 · MTBC0 mtbc0_002354 ·
311 aa ·
2511430–2512365 MTBC0
(+) ·
RefSeq NP_216734.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoyl synthase |
|---|---|
| MTBC0 PGAP re-annotation | lipoyl synthase |
| Revised (this work) | Lipoyl synthase. Pfam: LIAS_N (PF16881.11), Radical_SAM (PF04055.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 130 publications
130 TB publications mention this gene. 130 publication(s) discuss this gene (104 in a M. tuberculosis context, 14 in other mycobacteria — M. abscessus (11), M. smegmatis (3), M. leprae (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Extrapulmonary tuberculosis in Africa: Molecular analysis of clinical specimens of suspected cases in Northern Ghana. doi:10.1002/puh2.160 | 2024 |
| Alterations of lipid-related genes during anti-tuberculosis treatment: insights into host immune responses and potential transcriptional biomarkers. doi:10.3389/fimmu.2023.1210372 | 2023 |
| Health conditions of Hitnü indigenous people potentially exposed to crude oil in Arauca, Colombia. doi:10.7705/biomedica.6591 | 2022 |
| The immune-suppressive landscape in lepromatous leprosy revealed by single-cell RNA sequencing. doi:10.1038/s41421-021-00353-3 | 2022 |
| Biochemical Approaches to Probe the Role of the Auxiliary Iron-Sulfur Cluster of Lipoyl Synthase from Mycobacterium Tuberculosis. doi:10.1007/978-1-0716-1605-5_16 | 2021 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | lipB (Rv2217, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -5.04 (95% CI -5.43 to -4.66). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Lipoate biosynthesis |
|---|---|
| Mycobrowser EC |
2.8.1.8
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2241
· 100.0% identity |
|---|---|
| M. leprae |
ML0858c
· 86.5% identity |
| M. marinum |
MMAR_3286
· 88.4% identity |
| M. smegmatis |
MSMEG_4286
· 85.8% identity |
| M. orygis |
RJtmp_002289
· 100.0% identity |
| M. abscessus |
MAB_1942c
· 82.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WK91
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Lipoyl synthase |
| EC (curated) |
EC 2.8.1.8
|
| Curated function | Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | lipA |
| eggNOG description | Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives |
| Orthologous group | COG0320 |
| EC number |
EC 2.8.1.8
|
| KEGG orthology |
K03644
|
| KEGG pathways |
map00785, map01100
|
| Gene Ontology (64) |
GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006464, GO:0006629, GO:0006631, GO:0006633, GO:0006732 +52 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.089 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 89.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 69.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 15 in the ORF — 13 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.133, mean read count 46. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | lipA-FLAG-tetOn-10 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 4.937 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 11.6 ppm · rank 2617/3519 (25.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 311 aa |
|---|---|
| Molecular weight | 34.7 kDa |
| Theoretical pI | 8.47 |
| GRAVY | -0.364 (hydrophilic) |
| Aliphatic index | 85.3 |
| Aromaticity | 0.071 |
| Instability index | 46.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LIAS_N | PF16881.11 | 8.8e-09 | 18–60 | N-terminal domain of lipoyl synthase of Radical_SAM family |
Radical_SAM | PF04055.28 | 6.5e-19 | 78–233 | Radical SAM superfamily |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5exj |
X-ray diffraction | 1.64 Å | 100% |
5exk |
X-ray diffraction | 1.86 Å | 100% |
5exi |
X-ray diffraction | 2.28 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5exk-assembly4_G |
1.00 | 0.98 | 7.4e-53 sig | 5exk-assembly4_G Crystal structure of M. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate |
5exi-assembly1_A |
1.00 | 0.95 | 3.9e-48 sig | 5exi-assembly1_A Crystal structure of M. tuberculosis lipoyl synthase at 2.28 A resolution |
4u0p-assembly1_B |
1.00 | 0.92 | 1.6e-29 sig | 4u0p-assembly1_B The Crystal Structure of Lipoyl Synthase in Complex with S-Adenosyl Homocysteine |
4u0o-assembly1_B |
1.00 | 0.94 | 6.3e-29 sig | 4u0o-assembly1_B Crystal structure of Thermosynechococcus elongatus Lipoyl Synthase 2 complexed with MTA and DTT |
8vcw-assembly1_A |
1.00 | 0.56 | 6.0e-09 sig | 8vcw-assembly1_A X-Ray Crystal Structure of the biotin synthase from B. obeum |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) fold only
| M-CSA entry | 767 · EC 2.8.1.6 |
|---|---|
| Catalytic residues | 3/7 identical (7/7 aligned) |
| Verdict | FOLD-ONLY (3/7 identical although 7/7 aligned: catalytic residues SUBSTITUTED) -> same fold, active site NOT retained |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | lipB (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2219 (+ strand, 26 bp gap) |
| Predicted operon |
lipB · lipA · Rv2219
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: lipB (octanoyltransferase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2217 lipB exp |
octanoyltransferase | 999 | 1000 ctx | neighborhood:882 fusion:900 cooccurence:762 database:900 textmining:892 |
Rv2215 dlaT |
pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase | 949 | 921 ctx | neighborhood:808 cooccurence:591 |
Rv1826 gcvH exp |
glycine cleavage system protein H | 939 | 921 | database:844 |
Rv2219 |
transmembrane protein | 846 | 847 ctx | neighborhood:843 |
Rv2216 |
epimerase family protein | 839 | 810 ctx | neighborhood:808 |
Rv2495c bkdC |
branched-chain keto acid dehydrogenase E2 component | 797 | 623 ctx | cooccurence:590 textmining:486 |
Rv0462 lpdC |
dihydrolipoamide dehydrogenase | 573 | 540 ctx | cooccurence:490 |
Rv1449c tkt |
transketolase | 515 | 515 | coexpression:451 |
Rv1832 gcvB |
glycine dehydrogenase | 634 | 484 | |
Rv2535c pepQ exp |
cytoplasmic peptidase PepQ | 447 | 448 | database:424 |
Rv2089c pepE exp |
dipeptidase PepE | 443 | 443 | database:424 |
Rv3303c lpdA |
NAD(P)H quinone reductase LpdA | 469 | 427 | |
Rv2440c obg |
GTPase Obg | 438 | 413 | |
Rv2214c ephD |
oxidoreductase EphD | 436 | 408 ctx | neighborhood:400 |
Rv2211c gcvT |
aminomethyltransferase | 470 | 406 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoyl synthase
- MTBC0 PGAP product: lipoyl synthase
- Pfam (hmmscan --cut_ga): LIAS_N PF16881.11 (E=9e-09), Radical_SAM PF04055.28 (E=7e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216734.1)
- Domains: Pfam-A via hmmscan --cut_ga — LIAS_N (PF16881.11), Radical_SAM (PF04055.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0320 - Curated reference: UniProt P9WK91 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.4)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 767; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
lipB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002354|Rv2218|lipA MSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRVADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRPAFTYRRSLGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYEQARNSRALASR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lipA? Email the maintainer — the message is pre-filled with this gene's details.