lipA Resolved · high auto-curated

H37Rv Rv2218 · MTBC0 mtbc0_002354 · 311 aa · 2511430–2512365 (+) · RefSeq NP_216734.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoyl synthase
MTBC0 PGAP re-annotationlipoyl synthase
Revised (this work)Lipoyl synthase. Pfam: LIAS_N (PF16881.11), Radical_SAM (PF04055.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK91 SwissProt · reviewed · Evidence at protein level
UniProt nameLipoyl synthase
EC (curated) EC 2.8.1.8
Curated functionCatalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namelipA
eggNOG descriptionCatalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives
Orthologous groupCOG0320
EC number EC 2.8.1.8
KEGG orthology K03644
KEGG pathways map00785, map01100
Gene Ontology (64) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006464, GO:0006629, GO:0006631, GO:0006633, GO:0006732 +52 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.089 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LIAS_NPF16881.11 8.8e-0918–60 N-terminal domain of lipoyl synthase of Radical_SAM family
Radical_SAMPF04055.28 6.5e-1978–233 Radical SAM superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lipB (octanoyltransferase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2217 lipB octanoyltransferase 999 1000 ctx neighborhood:882 fusion:900 cooccurence:762 database:900 textmining:892
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 949 921 ctx neighborhood:808 cooccurence:591
Rv1826 gcvH glycine cleavage system protein H 939 921 database:844
Rv2219 transmembrane protein 846 847 ctx neighborhood:843
Rv2216 epimerase family protein 839 810 ctx neighborhood:808
Rv2495c bkdC branched-chain keto acid dehydrogenase E2 component 797 623 ctx cooccurence:590 textmining:486
Rv0462 lpdC dihydrolipoamide dehydrogenase 573 540 ctx cooccurence:490
Rv1449c tkt transketolase 515 515 coexpression:451
Rv1832 gcvB glycine dehydrogenase 634 484
Rv2535c pepQ cytoplasmic peptidase PepQ 447 448 database:424
Rv2089c pepE dipeptidase PepE 443 443 database:424
Rv3303c lpdA NAD(P)H quinone reductase LpdA 469 427
Rv2440c obg GTPase Obg 438 413
Rv2214c ephD oxidoreductase EphD 436 408 ctx neighborhood:400
Rv2211c gcvT aminomethyltransferase 470 406

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoyl synthase
  • MTBC0 PGAP product: lipoyl synthase
  • Pfam (hmmscan --cut_ga): LIAS_N PF16881.11 (E=9e-09), Radical_SAM PF04055.28 (E=7e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216734.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LIAS_N (PF16881.11), Radical_SAM (PF04055.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0320
  • Curated reference: UniProt P9WK91 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor lipB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002354|Rv2218|lipA
MSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRVADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRPAFTYRRSLGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYEQARNSRALASR