panB Resolved · high auto-curated

H37Rv Rv2225 · MTBC0 mtbc0_002363 · 281 aa · 2523899–2524744 (+) · RefSeq NP_216741.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-methyl-2-oxobutanoate hydroxymethyltransferase
MTBC0 PGAP re-annotation3-methyl-2-oxobutanoate hydroxymethyltransferase
Revised (this work)3-methyl-2-oxobutanoate hydroxymethyltransferase. Pfam: Pantoate_transf (PF02548.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIL7 SwissProt · reviewed · Evidence at protein level
UniProt name3-methyl-2-oxobutanoate hydroxymethyltransferase
EC (curated) EC 2.1.2.11
Curated functionCatalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namepanB
eggNOG descriptionCatalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate
Orthologous groupCOG0413
EC number EC 2.1.2.11
KEGG orthology K00606
KEGG pathways map00770, map01100, map01110
KEGG modules M00119
Gene Ontology (54) GO:0000287, GO:0003674, GO:0003824, GO:0003864, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006575, GO:0006732, GO:0006766 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.031 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pantoate_transfPF02548.22 1.2e-10720–276 Ketopantoate hydroxymethyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: panC (pantothenate synthetase), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3602c panC pantothenate synthetase 999 995 ctx fusion:811 cooccurence:774 coexpression:859 textmining:917
Rv3601c panD aspartate 1-decarboxylase 981 944 ctx cooccurence:581 coexpression:852 textmining:691
Rv2573 2-dehydropantoate 2-reductase 930 908 database:900
Rv2210c ilvE branched-chain amino acid aminotransferase 916 904 database:900
Rv0189c ilvD dihydroxy-acid dehydratase 929 901 database:900
Rv2226 hyp hypothetical protein 730 730 ctx neighborhood:726
Rv3603c hyp hypothetical protein 783 547 ctx cooccurence:484 textmining:541
Rv1832 gcvB glycine dehydrogenase 591 426 coexpression:407
Rv2438c nadE glutamine-dependent NAD(+) synthetase 429 410
Rv3396c guaA GMP synthase 710 392 textmining:543
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 421 337
Rv1940 ribA1 riboflavin biosynthesis protein RibA 421 337
Rv1391 dfp bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase 671 304 textmining:547
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 419 224
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 433 215

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase
  • MTBC0 PGAP product: 3-methyl-2-oxobutanoate hydroxymethyltransferase
  • Pfam (hmmscan --cut_ga): Pantoate_transf PF02548.22 (E=1e-107)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216741.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pantoate_transf (PF02548.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0413
  • Curated reference: UniProt P9WIL7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor panC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002363|Rv2225|panB
MSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDAAEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEHSF