Rv2219A Family assigned · medium auto-curated

H37Rv Rv2219A · MTBC0 - · 140 aa · 2486994–2487416 (-) · RefSeq YP_177661.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Membrane protein. Pfam: RDD (PF06271.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FG7 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionpfam rdd
Orthologous groupCOG1714

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.431 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RDDPF06271.19 6.4e-0824–120 RDD family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: glnA1 (glutamine synthetase), high confidence from genomic context alone (score 789 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2220 glnA1 glutamine synthetase 806 789 ctx neighborhood:759
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 661 661 ctx cooccurence:660
Rv2199c ctaF cytochrome c oxidase polypeptide 4 654 655 ctx cooccurence:640
Rv0102 integral membrane protein 558 559 ctx cooccurence:552
Rv2169c transmembrane protein 534 535 ctx cooccurence:532
Rv2242 hyp hypothetical protein 528 528 ctx cooccurence:526
Rv0528 transmembrane protein 522 523 ctx cooccurence:520
Rv0504c hyp hypothetical protein 474 475 ctx cooccurence:471
Rv1457c antibiotic ABC transporter permease 449 450 ctx cooccurence:443
Rv2146c transmembrane protein 434 435 ctx cooccurence:431
Rv0635 hadA (3R)-hydroxyacyl-ACP dehydratase subunit HadA 428 429 ctx cooccurence:425
Rv1342c hyp hypothetical protein 427 427 ctx cooccurence:418
Rv2206 transmembrane protein 410 411 ctx cooccurence:405
Rv3208A TB9.4 hyp hypothetical protein 408 409
Rv0360c hyp hypothetical protein 408 408 ctx cooccurence:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein
  • Pfam (hmmscan --cut_ga): RDD PF06271.19 (E=6e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177661.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RDD (PF06271.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1714
  • Curated reference: UniProt Q79FG7 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor glnA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2219A|
MTAKSPPDYPGKTLGLPDTGPGSLAPMGRRLAALLIDWLIAYGLALLGVEFGVWSTPMLSTVVLVIWLLLGVAAVRLFGFTPGQLMLGLVVVAVGGRRPVGIGRLVVRGLLIGLVVPPLFTDSDGRGLHDRLTATAVVRR