mmpS3 Family assigned · medium auto-curated

H37Rv Rv2198c · MTBC0 mtbc0_002334 · 299 aa · 2488305–2489204 (-) · RefSeq NP_216714.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein MmpS3
MTBC0 PGAP re-annotationMmpS family transport accessory protein
Revised (this work)MmpS family transport accessory protein. Pfam: Mycobact_memb (PF05423.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJT1 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable transport accessory protein MmpS3

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemmpS3
eggNOG descriptionMycobacterium membrane protein
Orthologous group2A3D5
Gene Ontology (14) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0030312, GO:0031224, GO:0031226, GO:0044425, GO:0044459 +2 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Mycobact_membPF05423.19 1.1e-06205–286 Mycobacterium membrane protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2197c (transmembrane protein), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2197c transmembrane protein 884 884 ctx neighborhood:881
Rv2199c ctaF cytochrome c oxidase polypeptide 4 699 699 ctx neighborhood:696
Rv2200c ctaC cytochrome C oxidase subunit II 526 527 ctx neighborhood:515
Rv2145c wag31 cell wall synthesis protein Wag31 534 86 textmining:512
Rv0020c fhaA FHA domain-containing protein FhaA 560 70 textmining:547
Rv2151c ftsQ cell division protein FtsQ 459 55 textmining:451
Rv0014c pknB serine/threonine-protein kinase PknB 440 54 textmining:433
Rv3628 ppa inorganic pyrophosphatase 521 52 textmining:516
Rv3360 hyp hypothetical protein 531 44 textmining:530

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein MmpS3
  • MTBC0 PGAP product: MmpS family transport accessory protein
  • Pfam (hmmscan --cut_ga): Mycobact_memb PF05423.19 (E=1e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216714.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Mycobact_memb (PF05423.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A3D5
  • Curated reference: UniProt P9WJT1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor Rv2197c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002334|Rv2198c|mmpS3
MSGPNPPGREPDEPESEPVSDTGDERASGNHLPPVAGGGDKLPSDQTGETDAYSRAYSAPESEHVTGGPYVPADLRLYDYDDYEESSDLDDELAAPRWPWVVGVAAIIAAVALVVSVSLLVTRPHTSKLATGDTTSSAPPVQDEITTTKPAPPPPPPAPPPTTEIPTATETQTVTVTPPPPPPPATTTAPPPATTTTAAAPPPTTTTPTGPRQVTYSVTGTKAPGDIISVTYVDAAGRRRTQHNVYIPWSMTVTPISQSDVGSVEASSLFRVSKLNCSITTSDGTVLSSNSNDGPQTSC