ctaE Family assigned · medium auto-curated

H37Rv Rv2193 · MTBC0 mtbc0_002329 · 203 aa · 2482908–2483519 (+) · RefSeq NP_216709.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cytochrome C oxidase subunit III
MTBC0 PGAP re-annotationheme-copper oxidase subunit III
Revised (this work)Heme-copper oxidase subunit III. Pfam: COX3 (PF00510.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP67 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable cytochrome c oxidase subunit 3
EC (curated) EC 7.1.1.9

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namectaE
eggNOG descriptioncytochrome c oxidase, subunit III
Orthologous groupCOG1845
EC number EC 1.9.3.1
KEGG orthology K02276, K02299
KEGG pathways map00190, map01100
KEGG modules M00155, M00417
Gene Ontology (8) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
COX3PF00510.24 1.8e-2622–201 Cytochrome c oxidase subunit III

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ctaD (cytochrome C oxidase cytochrome 1), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3043c ctaD cytochrome C oxidase cytochrome 1 999 1000 ctx cooccurence:774 coexpression:875 experimental:999 database:984 textmining:964
Rv2200c ctaC cytochrome C oxidase subunit II 999 1000 ctx cooccurence:774 coexpression:866 experimental:999 database:984 textmining:968
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 999 1000 ctx neighborhood:822 cooccurence:559 coexpression:823 experimental:999 textmining:879
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 999 1000 ctx neighborhood:822 cooccurence:506 coexpression:928 experimental:999 textmining:935
Rv2199c ctaF cytochrome c oxidase polypeptide 4 999 1000 ctx cooccurence:555 experimental:999 textmining:801
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 999 1000 ctx neighborhood:822 cooccurence:699 coexpression:958 experimental:999 textmining:831
Rv2876 transmembrane protein 999 999 experimental:999
Rv1451 ctaB protoheme IX farnesyltransferase 999 997 ctx cooccurence:773 coexpression:851 database:900 textmining:940
Rv1304 atpB ATP synthase subunit A 992 990 coexpression:890 experimental:916
Rv0863 hyp hypothetical protein 987 987 experimental:987
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 986 976 coexpression:859 experimental:794 textmining:451
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 981 976 coexpression:859 experimental:794
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 949 935 coexpression:685 experimental:775
Rv2782c pepR zinc protease 926 922 experimental:915
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 958 918 coexpression:618 experimental:794 textmining:518

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cytochrome C oxidase subunit III
  • MTBC0 PGAP product: heme-copper oxidase subunit III
  • Pfam (hmmscan --cut_ga): COX3 PF00510.24 (E=2e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216709.1)
  • Domains: Pfam-A via hmmscan --cut_ga — COX3 (PF00510.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1845
  • Curated reference: UniProt P9WP67 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 107 functional partner(s); context anchor ctaD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002329|Rv2193|ctaE
MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAFYFSARAQAGGNWPPPPTELNLYQAVPVTLVLIASSFTCQMGVFAAERGDIFGLRRWYVITFLMGLFFVLGQAYEYRNLMSHGTSIPSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFIR