mazF7 Resolved · high auto-curated
H37Rv Rv2063A · MTBC0 - ·
136 aa · 2321057–2321467 (+) ·
RefSeq YP_004837055.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | mRNA interferase MazF7 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | MRNA interferase MazF7. Pfam: PemK_toxin (PF02452.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P0CL62
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable endoribonuclease MazF7 |
| EC (curated) |
EC 3.1.-.-
|
| Curated function | Toxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis inhibits cell growth and colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin MazE7. Probably an endoribonuclease (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| eggNOG description | toxic component of a |
| Orthologous group | COG2337 |
| KEGG orthology |
K07171
|
| Gene Ontology (62) |
GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004521, GO:0004540, GO:0006139, GO:0006417, GO:0006725, GO:0006807, GO:0008150, GO:0008152 +50 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.412 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PemK_toxin | PF02452.24 | 5.0e-21 | 5–111 | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazE7 (antitoxin MazE7), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2063 mazE7 |
antitoxin MazE7 | 999 | 1000 ctx | neighborhood:881 experimental:999 textmining:650 |
Rv2801A mazE9 |
antitoxin MazE9 | 943 | 939 ctx | cooccurence:694 experimental:793 |
Rv2064 cobG |
precorrin-3B synthase | 897 | 897 ctx | neighborhood:882 |
Rv2065 cobH |
precorrin-8X methylmutase | 867 | 867 ctx | neighborhood:867 |
Rv2066 cobIJ |
bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase | 792 | 792 ctx | neighborhood:792 |
Rv0456A mazF1 |
toxin MazF1 | 729 | 729 ctx | cooccurence:729 |
Rv1991A mazE6 |
antitoxin MazE6 | 655 | 616 | experimental:434 |
Rv2062c cobN |
cobalamin biosynthesis protein CobN | 600 | 552 ctx | neighborhood:552 |
Rv1942c mazF5 |
toxin MazF5 | 546 | 546 ctx | cooccurence:546 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 528 | 528 ctx | cooccurence:528 |
Rv1953 vapC14 |
ribonuclease VapC14 | 462 | 461 ctx | cooccurence:458 |
Rv2548 vapC19 |
ribonuclease VapC19 | 452 | 451 ctx | cooccurence:448 |
Rv1397c vapC10 |
ribonuclease VapC10 | 791 | 418 ctx | cooccurence:414 textmining:657 |
Rv1725c hyp |
hypothetical protein | 412 | 413 | coexpression:413 |
Rv3095 |
HTH-type transcriptional regulator | 412 | 413 | coexpression:413 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): mRNA interferase MazF7
- Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=5e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837055.2)
- Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2337 - Curated reference: UniProt P0CL62 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
mazE7 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2063A|mazF7 MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGVRAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP