mazF7 Resolved · high auto-curated

H37Rv Rv2063A · MTBC0 - · 136 aa · 2321057–2321467 (+) · RefSeq YP_004837055.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mRNA interferase MazF7
MTBC0 PGAP re-annotation
Revised (this work)MRNA interferase MazF7. Pfam: PemK_toxin (PF02452.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P0CL62 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable endoribonuclease MazF7
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis inhibits cell growth and colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin MazE7. Probably an endoribonuclease (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptiontoxic component of a
Orthologous groupCOG2337
KEGG orthology K07171
Gene Ontology (62) GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004521, GO:0004540, GO:0006139, GO:0006417, GO:0006725, GO:0006807, GO:0008150, GO:0008152 +50 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.412 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PemK_toxinPF02452.24 5.0e-215–111 PemK-like, MazF-like toxin of type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazE7 (antitoxin MazE7), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2063 mazE7 antitoxin MazE7 999 1000 ctx neighborhood:881 experimental:999 textmining:650
Rv2801A mazE9 antitoxin MazE9 943 939 ctx cooccurence:694 experimental:793
Rv2064 cobG precorrin-3B synthase 897 897 ctx neighborhood:882
Rv2065 cobH precorrin-8X methylmutase 867 867 ctx neighborhood:867
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 792 792 ctx neighborhood:792
Rv0456A mazF1 toxin MazF1 729 729 ctx cooccurence:729
Rv1991A mazE6 antitoxin MazE6 655 616 experimental:434
Rv2062c cobN cobalamin biosynthesis protein CobN 600 552 ctx neighborhood:552
Rv1942c mazF5 toxin MazF5 546 546 ctx cooccurence:546
Rv1991c mazF6 mRNA interferase MazF6 528 528 ctx cooccurence:528
Rv1953 vapC14 ribonuclease VapC14 462 461 ctx cooccurence:458
Rv2548 vapC19 ribonuclease VapC19 452 451 ctx cooccurence:448
Rv1397c vapC10 ribonuclease VapC10 791 418 ctx cooccurence:414 textmining:657
Rv1725c hyp hypothetical protein 412 413 coexpression:413
Rv3095 HTH-type transcriptional regulator 412 413 coexpression:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): mRNA interferase MazF7
  • Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=5e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837055.2)
  • Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2337
  • Curated reference: UniProt P0CL62 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor mazE7
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2063A|mazF7
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGVRAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP