Rv2049c Family assigned · low auto-curated · to review

H37Rv Rv2049c · MTBC0 - · 74 aa · 2307293–2307517 (-) · RefSeq NP_216565.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 5lcy-assembly1_C Formaldehyde-Responsive Regulator FrmR E64H variant from Salmon (prob 1.00, TM 0.90). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53491 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2E5E7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 85.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5lcy-assembly1_C 1.00 0.90 1.5e-01 5lcy-assembly1_C Formaldehyde-Responsive Regulator FrmR E64H variant from Salmonella enterica serovar Typhimurium
4m1p-assembly1_A 0.99 0.89 3.9e-01 4m1p-assembly1_A Crystal structure of the copper-sensing repressor CsoR with Cu(I) from Geobacillus thermodenitrificans NG80-2
8cws-assembly1_B 0.98 0.86 4.7e-01 8cws-assembly1_B Accurate computational design of genetically encoded 3D protein crystals
6b87-assembly1_A-2 0.96 0.90 1.0e+00 6b87-assembly1_A-2 Crystal structure of transmembrane protein TMHC2_E
8cwy-assembly1_F 0.96 0.87 8.9e-01 8cwy-assembly1_F Accurate computational design of genetically encoded 3D protein crystals
8cwy-assembly1_B 0.94 0.87 1.0e+00 8cwy-assembly1_B Accurate computational design of genetically encoded 3D protein crystals
5j0k-assembly1_A 0.93 0.87 1.1e+00 5j0k-assembly1_A De novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity
2hh7-assembly1_A 0.93 0.81 8.3e-01 2hh7-assembly1_A Crystal Structure of Cu(I) bound CsoR from Mycobacterium tuberculosis.

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0556 (transmembrane protein), high confidence from genomic context alone (score 772 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0556 transmembrane protein 771 772 ctx cooccurence:771
Rv3212 hyp hypothetical protein 770 770 ctx cooccurence:767
Rv3438 hyp hypothetical protein 768 768 ctx cooccurence:767
Rv3311 hyp hypothetical protein 760 761 ctx cooccurence:758
Rv0996 transmembrane protein 754 755 ctx cooccurence:752
Rv2446c integral membrane protein 752 753 ctx cooccurence:751
Rv0882 transmembrane protein 746 747 ctx cooccurence:745
Rv1632c hyp hypothetical protein 740 741 ctx cooccurence:737
Rv0863 hyp hypothetical protein 729 730 ctx cooccurence:729
Rv2138 lppL lipoprotein LppL 723 723 ctx cooccurence:722
Rv2980 hyp hypothetical protein 718 718 ctx cooccurence:718
Rv0419 lpqM lipoprotein peptidase LpqM 704 704 ctx cooccurence:702
Rv3850 hyp hypothetical protein 695 696 ctx cooccurence:692
Rv3205c hyp hypothetical protein 695 695 ctx cooccurence:692
Rv0358 hyp hypothetical protein 688 689 ctx cooccurence:687

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 5lcy-assembly1_C Formaldehyde-Responsive Regulator FrmR E64H variant from Salmon (prob 1.00, E=1e-01, TM=0.90)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216565.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E5E7
  • Curated reference: UniProt O53491 (TrEMBL, unreviewed; Predicted)
  • Model confidence: ESMFold per-residue pLDDT (mean 85.7, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor Rv0556
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2049c|
MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWRRAGA