Rv2049c Family assigned · low auto-curated · to review
H37Rv Rv2049c · MTBC0 - ·
74 aa · 2307293–2307517 (-) ·
RefSeq NP_216565.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | No Pfam domain above threshold; Foldseek indicates a fold similar to 5lcy-assembly1_C Formaldehyde-Responsive Regulator FrmR E64H variant from Salmon (prob 1.00, TM 0.90). Structure-based, putative. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O53491
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2E5E7 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 85.7 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
5lcy-assembly1_C |
1.00 | 0.90 | 1.5e-01 | 5lcy-assembly1_C Formaldehyde-Responsive Regulator FrmR E64H variant from Salmonella enterica serovar Typhimurium |
4m1p-assembly1_A |
0.99 | 0.89 | 3.9e-01 | 4m1p-assembly1_A Crystal structure of the copper-sensing repressor CsoR with Cu(I) from Geobacillus thermodenitrificans NG80-2 |
8cws-assembly1_B |
0.98 | 0.86 | 4.7e-01 | 8cws-assembly1_B Accurate computational design of genetically encoded 3D protein crystals |
6b87-assembly1_A-2 |
0.96 | 0.90 | 1.0e+00 | 6b87-assembly1_A-2 Crystal structure of transmembrane protein TMHC2_E |
8cwy-assembly1_F |
0.96 | 0.87 | 8.9e-01 | 8cwy-assembly1_F Accurate computational design of genetically encoded 3D protein crystals |
8cwy-assembly1_B |
0.94 | 0.87 | 1.0e+00 | 8cwy-assembly1_B Accurate computational design of genetically encoded 3D protein crystals |
5j0k-assembly1_A |
0.93 | 0.87 | 1.1e+00 | 5j0k-assembly1_A De novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity |
2hh7-assembly1_A |
0.93 | 0.81 | 8.3e-01 | 2hh7-assembly1_A Crystal Structure of Cu(I) bound CsoR from Mycobacterium tuberculosis. |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0556 (transmembrane protein), high confidence from genomic context alone (score 772 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0556 |
transmembrane protein | 771 | 772 ctx | cooccurence:771 |
Rv3212 hyp |
hypothetical protein | 770 | 770 ctx | cooccurence:767 |
Rv3438 hyp |
hypothetical protein | 768 | 768 ctx | cooccurence:767 |
Rv3311 hyp |
hypothetical protein | 760 | 761 ctx | cooccurence:758 |
Rv0996 |
transmembrane protein | 754 | 755 ctx | cooccurence:752 |
Rv2446c |
integral membrane protein | 752 | 753 ctx | cooccurence:751 |
Rv0882 |
transmembrane protein | 746 | 747 ctx | cooccurence:745 |
Rv1632c hyp |
hypothetical protein | 740 | 741 ctx | cooccurence:737 |
Rv0863 hyp |
hypothetical protein | 729 | 730 ctx | cooccurence:729 |
Rv2138 lppL |
lipoprotein LppL | 723 | 723 ctx | cooccurence:722 |
Rv2980 hyp |
hypothetical protein | 718 | 718 ctx | cooccurence:718 |
Rv0419 lpqM |
lipoprotein peptidase LpqM | 704 | 704 ctx | cooccurence:702 |
Rv3850 hyp |
hypothetical protein | 695 | 696 ctx | cooccurence:692 |
Rv3205c hyp |
hypothetical protein | 695 | 695 ctx | cooccurence:692 |
Rv0358 hyp |
hypothetical protein | 688 | 689 ctx | cooccurence:687 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 5lcy-assembly1_C Formaldehyde-Responsive Regulator FrmR E64H variant from Salmon (prob 1.00, E=1e-01, TM=0.90)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216565.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2E5E7 - Curated reference: UniProt O53491 (TrEMBL, unreviewed; Predicted)
- Model confidence: ESMFold per-residue pLDDT (mean 85.7, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
74 functional partner(s); context anchor
Rv0556 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2049c| MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAATELRDLCDELIRAARAADGWRRAGA