rpmB1 Resolved · high auto-curated

H37Rv Rv0105c · MTBC0 - · 94 aa · 123980–124264 (-) · RefSeq YP_177691.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L28
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L28. Pfam: Ribosomal_L28 (PF00830.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHB1 SwissProt · reviewed · Inferred from homology
UniProt nameLarge ribosomal subunit protein bL28A

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmB
eggNOG descriptionBelongs to the bacterial ribosomal protein bL28 family
Orthologous groupCOG0227
KEGG orthology K02902
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (67) GO:0000027, GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0006412, GO:0006518 +55 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L28PF00830.25 1.2e-224–61 Ribosomal L28 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpmG1 (50S ribosomal protein L33), high confidence from genomic context alone (score 973 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0056 rplI 50S ribosomal protein L9 988 987 coexpression:707 experimental:956
Rv2057c rpmG1 50S ribosomal protein L33 993 973 ctx cooccurence:600 coexpression:672 experimental:789 textmining:783
Rv0979A rpmF 50S ribosomal protein L32 983 964 coexpression:730 experimental:829 textmining:561
Rv0053 rpsF 30S ribosomal protein S6 963 959 coexpression:728 experimental:829
Rv2442c rplU 50S ribosomal protein L21 959 954 coexpression:731 experimental:829
Rv2785c rpsO 30S ribosomal protein S15 959 954 coexpression:729 experimental:829
Rv2909c rpsP 30S ribosomal protein S16 959 954 coexpression:730 experimental:829
Rv2904c rplS 50S ribosomal protein L19 959 954 coexpression:731 experimental:829
Rv0682 rpsL 30S ribosomal protein S12 958 954 coexpression:728 experimental:829
Rv1298 rpmE 50S ribosomal protein L31 975 953 coexpression:719 experimental:829 textmining:511
Rv3443c rplM 50S ribosomal protein L13 958 953 coexpression:730 experimental:829
Rv2441c rpmA 50S ribosomal protein L27 958 953 coexpression:727 experimental:829
Rv2412 rpsT 30S ribosomal protein S20 958 953 coexpression:730 experimental:829
Rv1642 rpmI 50S ribosomal protein L35 958 953 coexpression:719 experimental:829
Rv0683 rpsG 30S ribosomal protein S7 958 953 coexpression:724 experimental:829

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L28
  • Pfam (hmmscan --cut_ga): Ribosomal_L28 PF00830.25 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177691.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L28 (PF00830.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0227
  • Curated reference: UniProt P9WHB1 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 202 functional partner(s); context anchor rpmG1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0105c|rpmB1
MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL